(data stored in ACNUC16935 zone)

EMBL: BN001307.PE389

BN001307.PE389       Location/Qualifiers
FT   CDS             join(1069203..1069246,1069417..1069457,1069523..1069620,
FT                   1069680..1070325,1070395..1070960,1071020..1071043)
FT                   /locus_tag="ANIA_01545"
FT                   /old_locus_tag="AN1545.4"
FT                   /product="hypothetical protein similar to protein
FT                   phosphatase 2A regulatory B subunit (Broad)"
FT                   /note="transcript_id=CADANIAT00008173"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008173"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008173"
FT                   /db_xref="GOA:C8VMY3"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMY3"
FT                   /protein_id="CBF85082.1"
FT                   /translation="MVDRDPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLA
FT                   TGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNAS
FT                   HFLLSTNDKTIKLWKVFDKSLKVVAENNLSTELTPGGVGGGGAPRAPRVSFKDSSALKL
FT                   PRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRVNLWNLNIQDQSFN
FT                   IVDIKPANMEELTEVITAAEFHPTSCNWFMYASSKGTIKLADMRQRALCDTHHKLFEQE
FT                   EDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLRP
FT                   RLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPAKETEIVLQADKSAFKA
FT                   KKVGVPTPMNKGANGKKSNSRTSSPAGPGSRMKKETDADQIDFNKKILHMSWHPFEDSI
FT                   AIAATNNLFVFSAL"
     MVDRDPGTPT WKFTQCFGDK GDVEDITEAD IISTVEFDHT GNYLATGDKG GRVVLFERNE        60
     TKKTCEYKFH TEFQSHEPEF DYLKSLEIEE KINKIKWCRR QNASHFLLST NDKTIKLWKV       120
     FDKSLKVVAE NNLSTELTPG GVGGGGAPRA PRVSFKDSSA LKLPRMTHHD TVVAAVPRRT       180
     YANAHAYHIN SISVNSDGET FISSDDLRVN LWNLNIQDQS FNIVDIKPAN MEELTEVITA       240
     AEFHPTSCNW FMYASSKGTI KLADMRQRAL CDTHHKLFEQ EEDASSRSFF SEIISSISDV       300
     RFSHDGRYIV SRDYLTVKIW DVNMERQPVK TIPIHEHLRP RLCDTYENDS IFDKFEVVFS       360
     GDAENVMTGS YNNNFMIYPT DPAKETEIVL QADKSAFKAK KVGVPTPMNK GANGKKSNSR       420
     TSSPAGPGSR MKKETDADQI DFNKKILHMS WHPFEDSIAI AATNNLFVFS AL               472
//

If you have problems or comments...

PBIL Back to PBIL home page