(data stored in ACNUC16935 zone)

EMBL: BN001307.PE391

BN001307.PE391       Location/Qualifiers
FT   CDS             join(1078912..1079054,1079105..1079345,1079394..1080587)
FT                   /locus_tag="ANIA_01547"
FT                   /old_locus_tag="AN1547.4"
FT                   /product="Acyl-CoA carboxylate CoA-transferasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BD33]"
FT                   /note="transcript_id=CADANIAT00008175"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008175"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008175"
FT                   /db_xref="GOA:Q5BD33"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD33"
FT                   /protein_id="CBF85085.1"
FT                   /translation="MSASALLRSRVRRPSYLNKIAKAEDLIDLFPNGSYIGWSGFTGVG
FT                   YPKKVPTALADHVEKNGLEGKLKYTLFVGASSGAETENRWARLNMIDRRSPHQVGKEIA
FT                   KGINNGQIKFFDKHLSMFPSDLTYGWYTLNKPKNRIDVAVIEASAITEDGGIIPGASVG
FT                   ASPELVQMADKVIIEVNTASPSFEGLHDITMSELPPNRKPYLILQPEDRIGTPHIPVDP
FT                   EKVVAIVESDYPDQTQPNSPEDANSQAIASNLIEFLKHEVKHGRLPPNLLPIQSGIGNI
FT                   ANAVIGGLSKGGADFTNLKVWTEVLQDSFLDLFDSGNLDFATATSIRFSPDGFKRFYDN
FT                   WERYAGKLLLRSQQVSNSPEIIRRLGCIGMNTPVEVDIYAHANSTCVMGSRMLNGLGGS
FT                   ADFLRSSKYSIMHTPSVRPSKTDPTGVSCIVPFATHIDQTEHDLDVIVTEQGLADVRGL
FT                   SPRERARVIIKKCSHPDYTPILTDYLDRAEFECLKKGMAHEPHLLFNAFKMHKNLQENG
FT                   TMKISNWD"
     MSASALLRSR VRRPSYLNKI AKAEDLIDLF PNGSYIGWSG FTGVGYPKKV PTALADHVEK        60
     NGLEGKLKYT LFVGASSGAE TENRWARLNM IDRRSPHQVG KEIAKGINNG QIKFFDKHLS       120
     MFPSDLTYGW YTLNKPKNRI DVAVIEASAI TEDGGIIPGA SVGASPELVQ MADKVIIEVN       180
     TASPSFEGLH DITMSELPPN RKPYLILQPE DRIGTPHIPV DPEKVVAIVE SDYPDQTQPN       240
     SPEDANSQAI ASNLIEFLKH EVKHGRLPPN LLPIQSGIGN IANAVIGGLS KGGADFTNLK       300
     VWTEVLQDSF LDLFDSGNLD FATATSIRFS PDGFKRFYDN WERYAGKLLL RSQQVSNSPE       360
     IIRRLGCIGM NTPVEVDIYA HANSTCVMGS RMLNGLGGSA DFLRSSKYSI MHTPSVRPSK       420
     TDPTGVSCIV PFATHIDQTE HDLDVIVTEQ GLADVRGLSP RERARVIIKK CSHPDYTPIL       480
     TDYLDRAEFE CLKKGMAHEP HLLFNAFKMH KNLQENGTMK ISNWD                       525
//

If you have problems or comments...

PBIL Back to PBIL home page