(data stored in ACNUC16935 zone)

EMBL: BN001307.PE393

BN001307.PE393       Location/Qualifiers
FT   CDS             complement(join(1082971..1083004,1083074..1083198,
FT                   1083297..1083398))
FT                   /locus_tag="ANIA_01549"
FT                   /old_locus_tag="AN1549.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008177"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008177"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008177"
FT                   /db_xref="GOA:Q5BD31"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD31"
FT                   /protein_id="CBF85089.1"
FT                   /translation="MVDDKSSTPAVSHARAHNDFGTNLWVRQGAVEHRHPTAGRGLFAG
FT                   LQDMKKYNVEHGWAKRNADASTGLGGWLWNKIFGGNYKPYD"
     MVDDKSSTPA VSHARAHNDF GTNLWVRQGA VEHRHPTAGR GLFAGLQDMK KYNVEHGWAK        60
     RNADASTGLG GWLWNKIFGG NYKPYD                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page