(data stored in ACNUC16935 zone)

EMBL: BN001307.PE394

BN001307.PE394       Location/Qualifiers
FT   CDS             complement(join(1085398..1085944,1086031..1087380,
FT                   1087578..1087594))
FT                   /locus_tag="ANIA_01550"
FT                   /old_locus_tag="AN1550.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008178"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008178"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008178"
FT                   /db_xref="GOA:Q5BD30"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD30"
FT                   /protein_id="CBF85091.1"
FT                   /translation="MIACCRPFIDKGTLERRNGIHWRMPAAMAVCWIIGLGLALGHHFY
FT                   YFSLDGTIVPGQTQQEWSLRVGTGLAFLTKTFLTTSVGIACVQNIWWILRMKPVRLSTL
FT                   DSMWDIRGNIFNFFDLHIWLRGPNVAILGLISWCVVLVYVVSSLLKCLRCIPLVTVVTP
FT                   STLSVRSTIGSMLQEQQMPAIDFNFDKFYTMDDGGPTGPTPSVTRFITGAVIQGTIPSI
FT                   PAPAPNSSYSLTFPGPLIQCSNSSANVSQQVYDWAHANYAHSTSFMGFMSETDNISHAM
FT                   NQLVYEPYQGPDNGDRDADVAGKLIMTVSPYMPLDKRWVVECGIYNASYSVDFNFTNGV
FT                   QSTRITDLQILGRVRDHRQHEIPPPANEDQLFAYTAMMRVFRDVLIGRCVQSGSICTDT
FT                   KIYSSALVNSKQIWQLVYNDKKKVGNTTYDSLGSILDVASELGRNITLSFFGSPYFLNT
FT                   SIGPLVNVTTHPSQTEYVYSQRNLLLAYGLSVFTSLLCIIAGLLTMWDNGIAFLDSPTT
FT                   ILRATRNPMFDEIVPTDSTTGADPTPESLSNTRVLWVQSASPGSNHTVAGLKPLPNTAE
FT                   PEKTGNDNRTANAGSETGLQAMTPITFSNGIPGWERKRYRPTISMVETETREASPPPGG
FT                   FI"
     MIACCRPFID KGTLERRNGI HWRMPAAMAV CWIIGLGLAL GHHFYYFSLD GTIVPGQTQQ        60
     EWSLRVGTGL AFLTKTFLTT SVGIACVQNI WWILRMKPVR LSTLDSMWDI RGNIFNFFDL       120
     HIWLRGPNVA ILGLISWCVV LVYVVSSLLK CLRCIPLVTV VTPSTLSVRS TIGSMLQEQQ       180
     MPAIDFNFDK FYTMDDGGPT GPTPSVTRFI TGAVIQGTIP SIPAPAPNSS YSLTFPGPLI       240
     QCSNSSANVS QQVYDWAHAN YAHSTSFMGF MSETDNISHA MNQLVYEPYQ GPDNGDRDAD       300
     VAGKLIMTVS PYMPLDKRWV VECGIYNASY SVDFNFTNGV QSTRITDLQI LGRVRDHRQH       360
     EIPPPANEDQ LFAYTAMMRV FRDVLIGRCV QSGSICTDTK IYSSALVNSK QIWQLVYNDK       420
     KKVGNTTYDS LGSILDVASE LGRNITLSFF GSPYFLNTSI GPLVNVTTHP SQTEYVYSQR       480
     NLLLAYGLSV FTSLLCIIAG LLTMWDNGIA FLDSPTTILR ATRNPMFDEI VPTDSTTGAD       540
     PTPESLSNTR VLWVQSASPG SNHTVAGLKP LPNTAEPEKT GNDNRTANAG SETGLQAMTP       600
     ITFSNGIPGW ERKRYRPTIS MVETETREAS PPPGGFI                                637
//

If you have problems or comments...

PBIL Back to PBIL home page