(data stored in ACNUC16935 zone)

EMBL: BN001307.PE395

BN001307.PE395       Location/Qualifiers
FT   CDS             complement(join(1088639..1090125,1090182..1090362))
FT                   /locus_tag="ANIA_01551"
FT                   /old_locus_tag="AN1551.4"
FT                   /product="Putative beta-glucosidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5BD29]"
FT                   /note="transcript_id=CADANIAT00008179"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008179"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008179"
FT                   /db_xref="GOA:Q5BD29"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD29"
FT                   /protein_id="CBF85093.1"
FT                   /translation="MRGAILATAAAFAGTAVADMHMRRHAHEGLHHRALHASSAVPEEE
FT                   CGCTTEVITYWGEPTTIPLSVPTSTVTSETTETVHSTSYSTVTVTATSSAAPVETPSET
FT                   PSPTPEVTLPTAGVTSYSETGTYTIPATTITVTDTTTVCGATTTELPSGTHTYGGVTTI
FT                   VETATTITCPYATVKPTGSTVTSVIETTTYVCPSAGTYTIAPTTTFVPTSTVVVYPTPE
FT                   TVTPGTYTNPGTTITVTRTEDVYVCPYTNGNVPTSVPALPTTSAASTTTAVPSSSTTTS
FT                   SATSVPTGASGNKMGMTFTPYNNDGSCMAKNDVLEQVGLIKGKGFSHVRVYGTDCHTLE
FT                   YVGAACSTHGLKMILGVNVEGSTGFDGARSQFKDITNWGQWDLVSLIVVGNEVVTSNIA
FT                   SAAQLASFVSEGASAFSAAGYTGQVTTAEPIDVWLSNGATLCPVVDILGANLHPFFNPE
FT                   FTAAEAGTLVSNQIKDLKQVCTGKDVINLETGWPNAGSANGKAIPGQSQQTTAIKSLVE
FT                   KVGDVSVFFSYADDGWKSKFATSDKYNVEQHWGCIDQF"
     MRGAILATAA AFAGTAVADM HMRRHAHEGL HHRALHASSA VPEEECGCTT EVITYWGEPT        60
     TIPLSVPTST VTSETTETVH STSYSTVTVT ATSSAAPVET PSETPSPTPE VTLPTAGVTS       120
     YSETGTYTIP ATTITVTDTT TVCGATTTEL PSGTHTYGGV TTIVETATTI TCPYATVKPT       180
     GSTVTSVIET TTYVCPSAGT YTIAPTTTFV PTSTVVVYPT PETVTPGTYT NPGTTITVTR       240
     TEDVYVCPYT NGNVPTSVPA LPTTSAASTT TAVPSSSTTT SSATSVPTGA SGNKMGMTFT       300
     PYNNDGSCMA KNDVLEQVGL IKGKGFSHVR VYGTDCHTLE YVGAACSTHG LKMILGVNVE       360
     GSTGFDGARS QFKDITNWGQ WDLVSLIVVG NEVVTSNIAS AAQLASFVSE GASAFSAAGY       420
     TGQVTTAEPI DVWLSNGATL CPVVDILGAN LHPFFNPEFT AAEAGTLVSN QIKDLKQVCT       480
     GKDVINLETG WPNAGSANGK AIPGQSQQTT AIKSLVEKVG DVSVFFSYAD DGWKSKFATS       540
     DKYNVEQHWG CIDQF                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page