(data stored in ACNUC16935 zone)

EMBL: BN001307.PE396

BN001307.PE396       Location/Qualifiers
FT   CDS             join(1093857..1093995,1094065..1094080,1094126..1094477)
FT                   /locus_tag="ANIA_01552"
FT                   /old_locus_tag="AN1552.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008180"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008180"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008180"
FT                   /db_xref="GOA:Q5BD28"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD28"
FT                   /protein_id="CBF85095.1"
FT                   /translation="MTRSELCPTFIPLFLPRIAAHYNQPDGFRLQTSTLVREFDQEKGA
FT                   AGDSAWKLASIHPAGIRLIMRLIHLRFQSYRARIVQPHMDSALPPVNQLYDFNMPRQNR
FT                   EKLSVLCYMASEPMEDTEWPRLRTATAISSPKEVGEESTNTTGKRCKPPSQVRKRNNAP
FT                   EEALS"
     MTRSELCPTF IPLFLPRIAA HYNQPDGFRL QTSTLVREFD QEKGAAGDSA WKLASIHPAG        60
     IRLIMRLIHL RFQSYRARIV QPHMDSALPP VNQLYDFNMP RQNREKLSVL CYMASEPMED       120
     TEWPRLRTAT AISSPKEVGE ESTNTTGKRC KPPSQVRKRN NAPEEALS                    168
//

If you have problems or comments...

PBIL Back to PBIL home page