(data stored in ACNUC16935 zone)

EMBL: BN001307.PE397

BN001307.PE397       Location/Qualifiers
FT   CDS             complement(join(1095953..1095980,1096047..1096429))
FT                   /locus_tag="ANIA_01553"
FT                   /old_locus_tag="AN1553.4"
FT                   /product="Asp hemolysin-like protein (AFU_orthologue;
FT                   AFUA_4G02805)"
FT                   /note="transcript_id=CADANIAT00008181"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008181"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008181"
FT                   /db_xref="GOA:Q5BD27"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD27"
FT                   /protein_id="CBF85097.1"
FT                   /translation="MTIPAEGLGEVCATGRRGSEGWLDLFDGDKKICELHWDNRAERRW
FT                   NDFEVLEPDEGYRVECSGWSSERGPLGHVFVDVSEARKEELRREKELGGLRVFEGPGVG
FT                   EKSVDVDVAEEVPVLGGLGGIGGNITMGGFIS"
     MTIPAEGLGE VCATGRRGSE GWLDLFDGDK KICELHWDNR AERRWNDFEV LEPDEGYRVE        60
     CSGWSSERGP LGHVFVDVSE ARKEELRREK ELGGLRVFEG PGVGEKSVDV DVAEEVPVLG       120
     GLGGIGGNIT MGGFIS                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page