(data stored in ACNUC16935 zone)

EMBL: BN001307.PE4

BN001307.PE4         Location/Qualifiers
FT   CDS             complement(join(10711..11238,11379..11489))
FT                   /locus_tag="ANIA_09508"
FT                   /old_locus_tag="AN9508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007796"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007796"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007796"
FT                   /db_xref="GOA:Q5AQC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQC2"
FT                   /protein_id="CBF84377.1"
FT                   /translation="MHSMPVVFAAQNPSAVKELHATIQCGVRPKGAGANKKSNNPAYYG
FT                   TKYPWVNEADGLNQDAVHDGFHLSSYLITAKYLFFDTEEGATALNLTTLPSDNQCSQAS
FT                   GFVFPPLVSTLDIPRDFPDHSSLPSTCAQFASLTLISATEVSPCRVNISPESERAFWPT
FT                   ECHNTLLPVSGCLDRTTKDDITGRDHGRAAWAAITLTFALIFGLGLVGY"
     MHSMPVVFAA QNPSAVKELH ATIQCGVRPK GAGANKKSNN PAYYGTKYPW VNEADGLNQD        60
     AVHDGFHLSS YLITAKYLFF DTEEGATALN LTTLPSDNQC SQASGFVFPP LVSTLDIPRD       120
     FPDHSSLPST CAQFASLTLI SATEVSPCRV NISPESERAF WPTECHNTLL PVSGCLDRTT       180
     KDDITGRDHG RAAWAAITLT FALIFGLGLV GY                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page