(data stored in ACNUC16935 zone)

EMBL: BN001307.PE40

BN001307.PE40        Location/Qualifiers
FT   CDS             complement(join(110677..110940,110963..111177,
FT                   111243..111270))
FT                   /locus_tag="ANIA_09022"
FT                   /old_locus_tag="AN9022.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007831"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007831"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007831"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKX8"
FT                   /protein_id="CBF84443.1"
FT                   /translation="MNTNGVVKIGCLEKCVLRDQNESHKAELVSVGNITMELLQKYVKN
FT                   EGRVGIDKLDRWSSDSVAVSFLSATTSANSIKTLMEENGALTYVSLQASPNKQNAFLQG
FT                   GTNRPRVVCTPFDENILVLCPTGKRETASFVSCWIKLLLRLSRSRICESCTSSKDSDIH
FT                   RSTRD"
     MNTNGVVKIG CLEKCVLRDQ NESHKAELVS VGNITMELLQ KYVKNEGRVG IDKLDRWSSD        60
     SVAVSFLSAT TSANSIKTLM EENGALTYVS LQASPNKQNA FLQGGTNRPR VVCTPFDENI       120
     LVLCPTGKRE TASFVSCWIK LLLRLSRSRI CESCTSSKDS DIHRSTRD                    168
//

If you have problems or comments...

PBIL Back to PBIL home page