(data stored in ACNUC16935 zone)

EMBL: BN001307.PE400

BN001307.PE400       Location/Qualifiers
FT   CDS             join(1109056..1109884,1109936..1111380)
FT                   /locus_tag="ANIA_10216"
FT                   /old_locus_tag="AN10216.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_8G05640)"
FT                   /note="transcript_id=CADANIAT00008184"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008184"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008184"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ4"
FT                   /protein_id="CBF85102.1"
FT                   /translation="MAPDDDAHPAGAHAANLPEQRLERPVDGLDSIATSLQDPYSDEAL
FT                   SAFMSVPHYPEATSHRTSIPVSEIVNAVIEPGDFFRRQSTSSQRISGSQISPPMELYVS
FT                   DSEMTDTLSEVGGVPLDEYHIEQMRLAEFASRFVHEAIAQNNHAAVSETTEEASATDSV
FT                   MQYELHTSGQEPISFSTAEDDDDTRKFYLDYGDDDYETNSQSSSSGDGHSHVSNVDLDD
FT                   FYRPPGYTYGSQMSGFDPASSHEDHTNFFSDAEDANTDPAADPHFAESVIHHGTTQERN
FT                   YDIDQFISQWLYQSSTASIPMLSLSPQVFLQSTLSNIMRWQPPAKITRPSGYTGDFYDI
FT                   QQIPWWERLRVRRADARRLRDQTYESYQNLPQYSQRRTGRRLPEEEFYFQGKSMYTAHK
FT                   ATIEHFQLRNLMSVPAYNTVHFAHESKLYSWVPAYDDLQCLIDLSVPNAESGFQGPVKI
FT                   STMKTAVGVSIAGGFFGEYAVRAMGTETKGVEGYVTKDPNGITNHIDIIPSRTNRSPIG
FT                   IFASNDRHVRTLDCETNTFLTDHELTHAVNCTSTSPDGRLRIVVGDSPDAWVVEAETGR
FT                   PVYPLRGHKDFGFACAWSPDMMQVATSNQDKSAIIWDARTWRMLEKIESDVAGYRSLRF
FT                   SPVGGGPRTLLLCEPADRIVIVNAQTYRSRQVHDFFGEVGGADYSPDGSTIWAANTDER
FT                   FGGFMEYDRRQWGQQYGLQQSPNEWVKEADLDEDERCILSERERQSRHLWNLCDEGHEE
FT                   LLLC"
     MAPDDDAHPA GAHAANLPEQ RLERPVDGLD SIATSLQDPY SDEALSAFMS VPHYPEATSH        60
     RTSIPVSEIV NAVIEPGDFF RRQSTSSQRI SGSQISPPME LYVSDSEMTD TLSEVGGVPL       120
     DEYHIEQMRL AEFASRFVHE AIAQNNHAAV SETTEEASAT DSVMQYELHT SGQEPISFST       180
     AEDDDDTRKF YLDYGDDDYE TNSQSSSSGD GHSHVSNVDL DDFYRPPGYT YGSQMSGFDP       240
     ASSHEDHTNF FSDAEDANTD PAADPHFAES VIHHGTTQER NYDIDQFISQ WLYQSSTASI       300
     PMLSLSPQVF LQSTLSNIMR WQPPAKITRP SGYTGDFYDI QQIPWWERLR VRRADARRLR       360
     DQTYESYQNL PQYSQRRTGR RLPEEEFYFQ GKSMYTAHKA TIEHFQLRNL MSVPAYNTVH       420
     FAHESKLYSW VPAYDDLQCL IDLSVPNAES GFQGPVKIST MKTAVGVSIA GGFFGEYAVR       480
     AMGTETKGVE GYVTKDPNGI TNHIDIIPSR TNRSPIGIFA SNDRHVRTLD CETNTFLTDH       540
     ELTHAVNCTS TSPDGRLRIV VGDSPDAWVV EAETGRPVYP LRGHKDFGFA CAWSPDMMQV       600
     ATSNQDKSAI IWDARTWRML EKIESDVAGY RSLRFSPVGG GPRTLLLCEP ADRIVIVNAQ       660
     TYRSRQVHDF FGEVGGADYS PDGSTIWAAN TDERFGGFME YDRRQWGQQY GLQQSPNEWV       720
     KEADLDEDER CILSERERQS RHLWNLCDEG HEELLLC                                757
//

If you have problems or comments...

PBIL Back to PBIL home page