(data stored in ACNUC16935 zone)

EMBL: BN001307.PE401

BN001307.PE401       Location/Qualifiers
FT   CDS             join(1111833..1112237,1112324..1112461)
FT                   /locus_tag="ANIA_10219"
FT                   /old_locus_tag="AN10219.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008185"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008185"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008185"
FT                   /db_xref="GOA:C8VMZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ5"
FT                   /protein_id="CBF85104.1"
FT                   /translation="MSLQNILVDAVKSHFDKDDDKDDLKPALSHASANASSEDSNLFSQ
FT                   ALSFINQRKSEGVQDDIDEEQAVNAHRRYEQGGNMDSKDFGAGAALQALKMFNSSSGQE
FT                   TGGGKDKNAFIGMAMAQAAKMWEEKAGKGEASGDKQSAINQAAEMAFKMYLKSQMSGSE
FT                   GTGGPGGLMSLASKFLK"
     MSLQNILVDA VKSHFDKDDD KDDLKPALSH ASANASSEDS NLFSQALSFI NQRKSEGVQD        60
     DIDEEQAVNA HRRYEQGGNM DSKDFGAGAA LQALKMFNSS SGQETGGGKD KNAFIGMAMA       120
     QAAKMWEEKA GKGEASGDKQ SAINQAAEMA FKMYLKSQMS GSEGTGGPGG LMSLASKFLK       180
//

If you have problems or comments...

PBIL Back to PBIL home page