(data stored in ACNUC16935 zone)

EMBL: BN001307.PE402

BN001307.PE402       Location/Qualifiers
FT   CDS             join(1113471..1113563,1113623..1114145,1114219..1114232,
FT                   1114281..1114856,1115048..1115488)
FT                   /locus_tag="ANIA_01557"
FT                   /old_locus_tag="AN1557.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008186"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008186"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008186"
FT                   /db_xref="GOA:Q5BD23"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD23"
FT                   /protein_id="CBF85105.1"
FT                   /translation="MFCGCMIGGSLWGTGKHLFELTSEQRTTAMEYWWFCNISYAVSSV
FT                   LAKVSVCIFLLRVMPFPCHRAALYTVTVLAVCSGIPFFVLLVIQCSPVSFWWTRMRGDT
FT                   NGHCGYVDAIAIMLYIFSASSALFDFTVALLPVILVRNLQMNRRTKAAVAGLLGMACVC
FT                   VIPLFLLADVFFGMLRAGKCSASIAIIIRLAFVQTIHDPDYLYGTVQIAIWSCIEVGLS
FT                   ITAGSLATTRPLFRILHNRSSSPYNPFDDPSTPSNDRNKHRRSISWSEPYPSSRSRRTS
FT                   NRILALENDLGFNFGSGRNNSISTSSRRRSRSSKSTSRPSTSRNKRRSGVTTEGRPSSN
FT                   FYEPYIGVEMLKMQSTTDVEGGRTDDTEGSSHPAPGTELLDPTTDPNSSGLGEFAGRPE
FT                   GLQTAASNYTAHLTTAVMRPRRWTSRDGLAEIGSTLAVVWETTPEVKAHCVKECSVQAS
FT                   SLHYFLAGSSESELYRQRPMRSYRAGGECSRFFFLTIGVLVQLDGQKSKVRISSIFSPF
FT                   STFYCIALSQGCRKYADHGRILSTIKATRPY"
     MFCGCMIGGS LWGTGKHLFE LTSEQRTTAM EYWWFCNISY AVSSVLAKVS VCIFLLRVMP        60
     FPCHRAALYT VTVLAVCSGI PFFVLLVIQC SPVSFWWTRM RGDTNGHCGY VDAIAIMLYI       120
     FSASSALFDF TVALLPVILV RNLQMNRRTK AAVAGLLGMA CVCVIPLFLL ADVFFGMLRA       180
     GKCSASIAII IRLAFVQTIH DPDYLYGTVQ IAIWSCIEVG LSITAGSLAT TRPLFRILHN       240
     RSSSPYNPFD DPSTPSNDRN KHRRSISWSE PYPSSRSRRT SNRILALEND LGFNFGSGRN       300
     NSISTSSRRR SRSSKSTSRP STSRNKRRSG VTTEGRPSSN FYEPYIGVEM LKMQSTTDVE       360
     GGRTDDTEGS SHPAPGTELL DPTTDPNSSG LGEFAGRPEG LQTAASNYTA HLTTAVMRPR       420
     RWTSRDGLAE IGSTLAVVWE TTPEVKAHCV KECSVQASSL HYFLAGSSES ELYRQRPMRS       480
     YRAGGECSRF FFLTIGVLVQ LDGQKSKVRI SSIFSPFSTF YCIALSQGCR KYADHGRILS       540
     TIKATRPY                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page