(data stored in ACNUC16935 zone)

EMBL: BN001307.PE404

BN001307.PE404       Location/Qualifiers
FT   CDS             complement(join(1121947..1122720,1122785..1122844))
FT                   /locus_tag="ANIA_01559"
FT                   /old_locus_tag="AN1559.4"
FT                   /product="OPA3 domain protein (AFU_orthologue;
FT                   AFUA_8G05670)"
FT                   /note="transcript_id=CADANIAT00008188"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008188"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008188"
FT                   /db_xref="GOA:C8VMZ8"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ8"
FT                   /protein_id="CBF85109.1"
FT                   /translation="MSLTLKLSSLVIRTLSKPIANQIKAQAREHERFRRICISMAQGLH
FT                   RLDMRLRLGTIRDNAAATRRAAAEAELRKHKPTSPTVKTEAETRAEEEAIARAKAAASE
FT                   AEKPAPKPHIRPLSESKAIESGATFISETFLFLVAGSLILFESWRSRRKENNRRDDVAA
FT                   RLNELEETVGIYREAFIALEKNGDLPPASRRILLKMIEDVEPEEVPEPEPQGWFTTITS
FT                   YFSFGQSPEKQPEKETDATQPASVAETPKVPSSTPRSGPAASSTTSVPVSKPEKP"
     MSLTLKLSSL VIRTLSKPIA NQIKAQAREH ERFRRICISM AQGLHRLDMR LRLGTIRDNA        60
     AATRRAAAEA ELRKHKPTSP TVKTEAETRA EEEAIARAKA AASEAEKPAP KPHIRPLSES       120
     KAIESGATFI SETFLFLVAG SLILFESWRS RRKENNRRDD VAARLNELEE TVGIYREAFI       180
     ALEKNGDLPP ASRRILLKMI EDVEPEEVPE PEPQGWFTTI TSYFSFGQSP EKQPEKETDA       240
     TQPASVAETP KVPSSTPRSG PAASSTTSVP VSKPEKP                                277
//

If you have problems or comments...

PBIL Back to PBIL home page