(data stored in ACNUC16935 zone)

EMBL: BN001307.PE406

BN001307.PE406       Location/Qualifiers
FT   CDS             join(1127406..1127610,1127697..1128130)
FT                   /locus_tag="ANIA_01561"
FT                   /old_locus_tag="AN1561.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008190"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008190"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008190"
FT                   /db_xref="GOA:Q5BD19"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD19"
FT                   /protein_id="CBF85113.1"
FT                   /translation="MIALALLAPLLAGQTIGSVSPSLKRDDSKSNAFTPGTTDGCPAGW
FT                   PTCGSSGICYNPDEGATCCPGGTYACPSSTFCLLDPYCCPDDLTPESCAKEYGLTLVPT
FT                   SPPSESTTFPPPKPSDSDSENDSGGHHRPTAHPTSSDSANSSITLSPTPIRTSSVVLWP
FT                   SLSVIPTGSPSAGQEPAYTGTGGSWRVRGGELATIAGAGALAIGVLCWV"
     MIALALLAPL LAGQTIGSVS PSLKRDDSKS NAFTPGTTDG CPAGWPTCGS SGICYNPDEG        60
     ATCCPGGTYA CPSSTFCLLD PYCCPDDLTP ESCAKEYGLT LVPTSPPSES TTFPPPKPSD       120
     SDSENDSGGH HRPTAHPTSS DSANSSITLS PTPIRTSSVV LWPSLSVIPT GSPSAGQEPA       180
     YTGTGGSWRV RGGELATIAG AGALAIGVLC WV                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page