(data stored in ACNUC16935 zone)

EMBL: BN001307.PE407

BN001307.PE407       Location/Qualifiers
FT   CDS             complement(1129892..1130815)
FT                   /locus_tag="ANIA_01562"
FT                   /old_locus_tag="AN1562.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008191"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008191"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008191"
FT                   /db_xref="GOA:Q5BD18"
FT                   /db_xref="InterPro:IPR041622"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD18"
FT                   /protein_id="CBF85115.1"
FT                   /translation="MGQERPTGRSLARRLLLAALDREEQGYPPAHQSLYPTIGSINYDP
FT                   TVETPEPTDARARRFTINRTDASVLIPPSDKLLVFRALTGIDSTPALNLSHHTPRTAPN
FT                   IGIYTRVVRAETKAAKRYRFHAALINTCLGIQIVVAAALTALGAARGPHNAVTAFGAIN
FT                   TIVAGILTYLKGSGLPDRLKHYQNEWRNIREYIEQRERELCLEGCGLDVEEEIRIIEQM
FT                   YEGVKREIEATKSGGDNRSFSRDRTSTRRPVIQQTEQSREYAPRRSPSPARTSEAFEKH
FT                   YHEPRREFTPRPPSPARVHERFEKHY"
     MGQERPTGRS LARRLLLAAL DREEQGYPPA HQSLYPTIGS INYDPTVETP EPTDARARRF        60
     TINRTDASVL IPPSDKLLVF RALTGIDSTP ALNLSHHTPR TAPNIGIYTR VVRAETKAAK       120
     RYRFHAALIN TCLGIQIVVA AALTALGAAR GPHNAVTAFG AINTIVAGIL TYLKGSGLPD       180
     RLKHYQNEWR NIREYIEQRE RELCLEGCGL DVEEEIRIIE QMYEGVKREI EATKSGGDNR       240
     SFSRDRTSTR RPVIQQTEQS REYAPRRSPS PARTSEAFEK HYHEPRREFT PRPPSPARVH       300
     ERFEKHY                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page