(data stored in ACNUC16935 zone)

EMBL: BN001307.PE408

BN001307.PE408       Location/Qualifiers
FT   CDS             complement(join(1132664..1132912,1132968..1132991))
FT                   /locus_tag="ANIA_11307"
FT                   /old_locus_tag="AN11307.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008192"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008192"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008192"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN02"
FT                   /protein_id="CBF85117.1"
FT                   /translation="MPGRQRIQHKQDEPVPDYEALEAEARRYKHAVFLLVETIRKNSPA
FT                   DTLELIDAIRNTKSVSEAAGLVMQLSETASSPEGGTQRDSEARSQ"
     MPGRQRIQHK QDEPVPDYEA LEAEARRYKH AVFLLVETIR KNSPADTLEL IDAIRNTKSV        60
     SEAAGLVMQL SETASSPEGG TQRDSEARSQ                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page