(data stored in ACNUC16935 zone)

EMBL: BN001307.PE41

BN001307.PE41        Location/Qualifiers
FT   CDS             join(112517..112928,112979..113277,113327..115618)
FT                   /locus_tag="ANIA_09021"
FT                   /old_locus_tag="AN9021.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007832"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007832"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007832"
FT                   /db_xref="GOA:Q5ARQ9"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ9"
FT                   /protein_id="CBF84445.1"
FT                   /translation="MRRALFNEDDAKQARERRLKYQGTARVKISEIGFDSANYIDDKNV
FT                   ERLCGIFRKSGCRRFDVEHHIPATVSRNALAEALQKAGVPARALLLSSGEDTPFLTFSR
FT                   GQLVGLHGRHRLSAGARVLAPLERWWTVDLFLDDISKDLRVSLVEEYSNQKKLTDGEIY
FT                   WTIRQYESEGSSLLRQKWFTRLSDWKQKRIKQLDREENRQLREAFDRLLTIQGLWYDGM
FT                   RLGMIHRLIALAATEEILTYFDHIYETYLFFVNGDRGSLNRIDTETVLGLQLKCPRVCE
FT                   KDRKEVNGLVLSGQVFSSFSESERRNICRRLQSFDGIIPSLYTFWEDFKYLECCAQCIR
FT                   RLFGQVNGSIWNTMKHMFVGTADEDYGIVQTSEFSFRRQTAGNNERLDLGYRQLWLYAM
FT                   RNYRLLPQPAKEEEELLVKPSRREADDRVLYEMAELARRLGFWSDEIRALLDGSPDRQI
FT                   ARAALLQARKPDQFQYDPVQLEGLVDRVVACFSAAIEYVRQPPELLADSEVSTRARRGL
FT                   PQVKAHAQDAPHLFLDKVHNEVTSSSATLTTFFVRRCVYFAFFGKCSLSGSRVRDLGPG
FT                   GPPGDTPGLFVNENMQTTGASSTVPESTVAQGSGTRPTHEDIPTRQRLEGHSEPILEDG
FT                   VGRSSQLALSGENTGYDEMADEGTRSHSPANQVATSGIPESLSLGLQRVSSADASSLNG
FT                   EQLGHQNAEQTPLSRDSDWPSTPAESNLDTSLGEQPQPMDYSPSIYSVRESGARNTGTG
FT                   AERQYSQELERAIQERERLDNDWERERLEQELGLPTSSSAQGEIAPVQCSKEDEVPETL
FT                   RQTVEPPDGSDQEPSSSNVGTNDQQTREPLTQGDRPVTLLDIHNSALVPSGRQGGQSPT
FT                   AGAFEDSRVEDRMELVEFTFWSLERGQWRRADHLWVDPADTFRVELIAKKYIWKDFSLY
FT                   DRHWNSLSPAQCFRAATVDGSNAIFVVSEDEERRLQAEGRRMKMTQIQAISHRAGSDPT
FT                   EPERQLKRNRL"
     MRRALFNEDD AKQARERRLK YQGTARVKIS EIGFDSANYI DDKNVERLCG IFRKSGCRRF        60
     DVEHHIPATV SRNALAEALQ KAGVPARALL LSSGEDTPFL TFSRGQLVGL HGRHRLSAGA       120
     RVLAPLERWW TVDLFLDDIS KDLRVSLVEE YSNQKKLTDG EIYWTIRQYE SEGSSLLRQK       180
     WFTRLSDWKQ KRIKQLDREE NRQLREAFDR LLTIQGLWYD GMRLGMIHRL IALAATEEIL       240
     TYFDHIYETY LFFVNGDRGS LNRIDTETVL GLQLKCPRVC EKDRKEVNGL VLSGQVFSSF       300
     SESERRNICR RLQSFDGIIP SLYTFWEDFK YLECCAQCIR RLFGQVNGSI WNTMKHMFVG       360
     TADEDYGIVQ TSEFSFRRQT AGNNERLDLG YRQLWLYAMR NYRLLPQPAK EEEELLVKPS       420
     RREADDRVLY EMAELARRLG FWSDEIRALL DGSPDRQIAR AALLQARKPD QFQYDPVQLE       480
     GLVDRVVACF SAAIEYVRQP PELLADSEVS TRARRGLPQV KAHAQDAPHL FLDKVHNEVT       540
     SSSATLTTFF VRRCVYFAFF GKCSLSGSRV RDLGPGGPPG DTPGLFVNEN MQTTGASSTV       600
     PESTVAQGSG TRPTHEDIPT RQRLEGHSEP ILEDGVGRSS QLALSGENTG YDEMADEGTR       660
     SHSPANQVAT SGIPESLSLG LQRVSSADAS SLNGEQLGHQ NAEQTPLSRD SDWPSTPAES       720
     NLDTSLGEQP QPMDYSPSIY SVRESGARNT GTGAERQYSQ ELERAIQERE RLDNDWERER       780
     LEQELGLPTS SSAQGEIAPV QCSKEDEVPE TLRQTVEPPD GSDQEPSSSN VGTNDQQTRE       840
     PLTQGDRPVT LLDIHNSALV PSGRQGGQSP TAGAFEDSRV EDRMELVEFT FWSLERGQWR       900
     RADHLWVDPA DTFRVELIAK KYIWKDFSLY DRHWNSLSPA QCFRAATVDG SNAIFVVSED       960
     EERRLQAEGR RMKMTQIQAI SHRAGSDPTE PERQLKRNRL                            1000
//

If you have problems or comments...

PBIL Back to PBIL home page