(data stored in ACNUC16935 zone)

EMBL: BN001307.PE410

BN001307.PE410       Location/Qualifiers
FT   CDS             complement(join(1137168..1138981,1139031..1139413,
FT                   1139461..1139867))
FT                   /locus_tag="ANIA_01564"
FT                   /old_locus_tag="AN1564.4"
FT                   /product="DNA mismatch repair protein, putative
FT                   (AFU_orthologue; AFUA_8G05820)"
FT                   /note="transcript_id=CADANIAT00008194"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008194"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008194"
FT                   /db_xref="GOA:Q5BD16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD16"
FT                   /protein_id="CBF85120.1"
FT                   /translation="MPIVALPPATVRAIGSTSIISDPYSLAKELLDNALDAFATLVSVE
FT                   ISQDTVGLLQVKDNGHGIPADDYMVVCKRTFTSKIHTVEDLQKVGGKSLGFRGEALASA
FT                   AELSGALNISTRVETDPVGSSLEYGRNGELTRTERISHPVGTTVRILNLFQQIPVRRQT
FT                   AIKNSKKTLLKIKKMVQAYAMARPSIRLSFKVLKAKNESLNWMYAPGENGTLTEAALRV
FT                   GGTGIAPNCILKNWPTPSKDGNASPEDLGFRLVALLPKVGSDITKFNNLGQYISVDNRP
FT                   LSSGRGFAQDITKLFRRYLRSAASRDGLSPPINDPFLCVHVLCLGGAYDANIEPSKDDV
FT                   LFENQQAVLSLVEDLLRDTYGDLSNVHEDHGSTGQGRGTSQRNGFEALLSKKQQSAALS
FT                   TPALDSSPQERSSVSARLFARPESCRSPPEPHSCGEQADRSLLTRLNNPRATMGTASPV
FT                   VDAQDQGRLSLHKKIHLPGININPRETRQRDDVRPCLPSPTSSADSPAAALNTTPSSSL
FT                   GPSQLSPATSARDRQQQRQIGRERYGNGSLDTWFLKLSQSSQSPAATEEPETQIEDPPL
FT                   SQLTQDYFGTERARPNGTSDLANNPSQTASEISLQDSLADSGSTEGSPRTLARPARFVN
FT                   KPGLPVLEQWSARLYSAASPEENPELQKALEFETRKKAAIQERRMQLQNPKPTTSKNSP
FT                   HQSRYLAARAALSSQPRPSSVTQQSRSELGEISSHGTGVSKTFLSPQDPRAYLIQLQNS
FT                   DVPGGPKLKRISSAKLPFEKIPEEHDLHSMGLTLPAGLPLIYSSFKNLWINDLYTQSGE
FT                   QVEGFVSPDIKTAFESWDAHLSSLIRARYRLAKNSDIPNLQFDFSELSRVSQGSG"
     MPIVALPPAT VRAIGSTSII SDPYSLAKEL LDNALDAFAT LVSVEISQDT VGLLQVKDNG        60
     HGIPADDYMV VCKRTFTSKI HTVEDLQKVG GKSLGFRGEA LASAAELSGA LNISTRVETD       120
     PVGSSLEYGR NGELTRTERI SHPVGTTVRI LNLFQQIPVR RQTAIKNSKK TLLKIKKMVQ       180
     AYAMARPSIR LSFKVLKAKN ESLNWMYAPG ENGTLTEAAL RVGGTGIAPN CILKNWPTPS       240
     KDGNASPEDL GFRLVALLPK VGSDITKFNN LGQYISVDNR PLSSGRGFAQ DITKLFRRYL       300
     RSAASRDGLS PPINDPFLCV HVLCLGGAYD ANIEPSKDDV LFENQQAVLS LVEDLLRDTY       360
     GDLSNVHEDH GSTGQGRGTS QRNGFEALLS KKQQSAALST PALDSSPQER SSVSARLFAR       420
     PESCRSPPEP HSCGEQADRS LLTRLNNPRA TMGTASPVVD AQDQGRLSLH KKIHLPGINI       480
     NPRETRQRDD VRPCLPSPTS SADSPAAALN TTPSSSLGPS QLSPATSARD RQQQRQIGRE       540
     RYGNGSLDTW FLKLSQSSQS PAATEEPETQ IEDPPLSQLT QDYFGTERAR PNGTSDLANN       600
     PSQTASEISL QDSLADSGST EGSPRTLARP ARFVNKPGLP VLEQWSARLY SAASPEENPE       660
     LQKALEFETR KKAAIQERRM QLQNPKPTTS KNSPHQSRYL AARAALSSQP RPSSVTQQSR       720
     SELGEISSHG TGVSKTFLSP QDPRAYLIQL QNSDVPGGPK LKRISSAKLP FEKIPEEHDL       780
     HSMGLTLPAG LPLIYSSFKN LWINDLYTQS GEQVEGFVSP DIKTAFESWD AHLSSLIRAR       840
     YRLAKNSDIP NLQFDFSELS RVSQGSG                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page