(data stored in ACNUC16935 zone)

EMBL: BN001307.PE411

BN001307.PE411       Location/Qualifiers
FT   CDS             join(1140151..1140485,1140535..1140706,1140753..1141052,
FT                   1141102..1141180,1141227..1141648)
FT                   /locus_tag="ANIA_01565"
FT                   /old_locus_tag="AN1565.4"
FT                   /product="Palmitoyltransferase pfa4 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 4)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD15]"
FT                   /note="transcript_id=CADANIAT00008195"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008195"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008195"
FT                   /db_xref="GOA:Q5BD15"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD15"
FT                   /protein_id="CBF85122.1"
FT                   /translation="MLCSSFSVSRLAIPAVCILIAFLAYTSQIFFLYFEDAPLKEDEVW
FT                   RINILAICIWICYYRACTVDPGHVPKGWMPSDRERLKADRASGRQRWCRRCEAYKPPRA
FT                   HHCKTCERCVPKMDHHCPWTSNCVSHFTFPHFARFLFYAVVGIAYLETRLWQRVSKVWG
FT                   SRHLPSYLGPSMGQIGHLFVLFVTNSLTLFALSLLLLRTLWSLGSNTTTIESWEIERHE
FT                   TLLRRARRLGGSLPGPGGISVHITKQEFPYDIGIWSNIRAGMGGSANVLSWFWPLARTP
FT                   DRSTGLEFEENGFEDPTVSWPPPDPDRIPLPPMDQRDSFMYDITDTSGTSGQIDIEAFN
FT                   RRKEADLRRRRAPTEIERRKPFHVRLEEYSNGSSDAEADTGSDDDSDHGEEGWKNSEGE
FT                   RLRDFGVDEEAEFYDEEDIPLALLIQQRAKRQHLSQ"
     MLCSSFSVSR LAIPAVCILI AFLAYTSQIF FLYFEDAPLK EDEVWRINIL AICIWICYYR        60
     ACTVDPGHVP KGWMPSDRER LKADRASGRQ RWCRRCEAYK PPRAHHCKTC ERCVPKMDHH       120
     CPWTSNCVSH FTFPHFARFL FYAVVGIAYL ETRLWQRVSK VWGSRHLPSY LGPSMGQIGH       180
     LFVLFVTNSL TLFALSLLLL RTLWSLGSNT TTIESWEIER HETLLRRARR LGGSLPGPGG       240
     ISVHITKQEF PYDIGIWSNI RAGMGGSANV LSWFWPLART PDRSTGLEFE ENGFEDPTVS       300
     WPPPDPDRIP LPPMDQRDSF MYDITDTSGT SGQIDIEAFN RRKEADLRRR RAPTEIERRK       360
     PFHVRLEEYS NGSSDAEADT GSDDDSDHGE EGWKNSEGER LRDFGVDEEA EFYDEEDIPL       420
     ALLIQQRAKR QHLSQ                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page