(data stored in ACNUC16935 zone)

EMBL: BN001307.PE412

BN001307.PE412       Location/Qualifiers
FT   CDS             complement(join(1141704..1142205,1142278..1142561,
FT                   1142617..1142670))
FT                   /locus_tag="ANIA_01566"
FT                   /old_locus_tag="AN1566.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008196"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008196"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008196"
FT                   /db_xref="GOA:C8VN06"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN06"
FT                   /protein_id="CBF85124.1"
FT                   /translation="MSATQQTQAERKDNWSSEAYSASAAFVPKLTQTLLQYLDPQPSDS
FT                   VLDIGCGDGKFTELFLPYVSKVLGVDSSPAMIEAARKGYGSEKAEFQVLDCCFLEQNSD
FT                   VADGTWDKVVSNAALHWILRNEKTRLSTLKGIHASLKKGGAFVFEMGGHGNVAEIQAAM
FT                   QYALLRQGISIEKARESYPWFFPSVPWMSSTLESLGFKVVKMESEYRPTKLTSDTNGGL
FT                   AGWVRLMGAAFLDVVDTEKREEVIREVCEVLQTVTTREEDGSQWLGYVRLRGVAVKI"
     MSATQQTQAE RKDNWSSEAY SASAAFVPKL TQTLLQYLDP QPSDSVLDIG CGDGKFTELF        60
     LPYVSKVLGV DSSPAMIEAA RKGYGSEKAE FQVLDCCFLE QNSDVADGTW DKVVSNAALH       120
     WILRNEKTRL STLKGIHASL KKGGAFVFEM GGHGNVAEIQ AAMQYALLRQ GISIEKARES       180
     YPWFFPSVPW MSSTLESLGF KVVKMESEYR PTKLTSDTNG GLAGWVRLMG AAFLDVVDTE       240
     KREEVIREVC EVLQTVTTRE EDGSQWLGYV RLRGVAVKI                              279
//

If you have problems or comments...

PBIL Back to PBIL home page