(data stored in ACNUC16935 zone)

EMBL: BN001307.PE413

BN001307.PE413       Location/Qualifiers
FT   CDS             join(1144464..1144768,1144844..1144920,1144975..1144994)
FT                   /locus_tag="ANIA_01567"
FT                   /old_locus_tag="AN1567.4"
FT                   /product="MBL2-like secreted peptide, putative
FT                   (AFU_orthologue; AFUA_5G00910)"
FT                   /note="transcript_id=CADANIAT00008197"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008197"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008197"
FT                   /db_xref="GOA:C8VN07"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN07"
FT                   /protein_id="CBF85125.1"
FT                   /translation="MKFTVAGVLALASLALAMPAPEAAAVAEAEALEAPVPVDISPEAL
FT                   GLEKRANTVCKIVNSSSSKVNCRTGPGFDYPASYSVIPGKYYEFRCYKSGDCYNGNCTW
FT                   QRINWDGKTCYVNGYYTDSKCTVAALGKC"
     MKFTVAGVLA LASLALAMPA PEAAAVAEAE ALEAPVPVDI SPEALGLEKR ANTVCKIVNS        60
     SSSKVNCRTG PGFDYPASYS VIPGKYYEFR CYKSGDCYNG NCTWQRINWD GKTCYVNGYY       120
     TDSKCTVAAL GKC                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page