(data stored in ACNUC16935 zone)

EMBL: BN001307.PE414

BN001307.PE414       Location/Qualifiers
FT   CDS             complement(join(1146366..1147412,1147482..1148045,
FT                   1148094..1148294))
FT                   /locus_tag="ANIA_01568"
FT                   /old_locus_tag="AN1568.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008198"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008198"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008198"
FT                   /db_xref="GOA:C8VN08"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN08"
FT                   /protein_id="CBF85127.1"
FT                   /translation="MGKGKPRLLLNHRPSIHPSKMQIKSGYYIGIDVGTGSARACIIDH
FT                   NGDIVGLASKDIGLWQPEQQHYEQSTLNIWQCICASVQQALAERAIPSSQVHGIGFDAT
FT                   CSLAVFSKTTNKPVSVTRQGGFSTERNVILWLDHRAVKETELINATGHKVLKYVGGTMS
FT                   PEMEMPKILWLKNQMPPEVFADCKFYDLVDALTHIATGEETRSYCSLVCKQGYLPSQVE
FT                   GSTTGWQGDFLESIGLGELAADGFARIGGVNGETGQHLSAGERAGRLSARAAKELGLPP
FT                   GIAVGAGVIDAYAGWIGTVGTKIDGVDVVGNHNRADAFNRLAAVAGTSTCHIAMSSNPV
FT                   FVPGVWGPYRDTVFRGCWMAEGGQSATGQLLKHVLDTHPASKSAFAVAADRGLDIFSFL
FT                   DGHLAALAAKQNLPCIAALARHFFFYGDFFGNRSPLADPNMTGSVVGLTADTSIDSLAI
FT                   HYYGTLEFIALQTRQIVETMNKAGHAITSIFMSGSQCKNRTLVKLIATACNMPVIVPRG
FT                   RHVEAAVCHGAAMLGVKAANLDAPGKTVDLWDVIEQTSKPGDVCHPTTAEYERALLAAK
FT                   YQVFLDQCTRQREYREMVDRVAFPNQV"
     MGKGKPRLLL NHRPSIHPSK MQIKSGYYIG IDVGTGSARA CIIDHNGDIV GLASKDIGLW        60
     QPEQQHYEQS TLNIWQCICA SVQQALAERA IPSSQVHGIG FDATCSLAVF SKTTNKPVSV       120
     TRQGGFSTER NVILWLDHRA VKETELINAT GHKVLKYVGG TMSPEMEMPK ILWLKNQMPP       180
     EVFADCKFYD LVDALTHIAT GEETRSYCSL VCKQGYLPSQ VEGSTTGWQG DFLESIGLGE       240
     LAADGFARIG GVNGETGQHL SAGERAGRLS ARAAKELGLP PGIAVGAGVI DAYAGWIGTV       300
     GTKIDGVDVV GNHNRADAFN RLAAVAGTST CHIAMSSNPV FVPGVWGPYR DTVFRGCWMA       360
     EGGQSATGQL LKHVLDTHPA SKSAFAVAAD RGLDIFSFLD GHLAALAAKQ NLPCIAALAR       420
     HFFFYGDFFG NRSPLADPNM TGSVVGLTAD TSIDSLAIHY YGTLEFIALQ TRQIVETMNK       480
     AGHAITSIFM SGSQCKNRTL VKLIATACNM PVIVPRGRHV EAAVCHGAAM LGVKAANLDA       540
     PGKTVDLWDV IEQTSKPGDV CHPTTAEYER ALLAAKYQVF LDQCTRQREY REMVDRVAFP       600
     NQV                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page