(data stored in ACNUC16935 zone)

EMBL: BN001307.PE417

BN001307.PE417       Location/Qualifiers
FT   CDS             1154744..1156180
FT                   /locus_tag="ANIA_10218"
FT                   /old_locus_tag="AN10218.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008201"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008201"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008201"
FT                   /db_xref="GOA:C8VN11"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN11"
FT                   /protein_id="CBF85132.1"
FT                   /translation="MPTTSRHKHRIYFAYGINMHLKQMAKRCPNTRYLGVAKLSGYRWQ
FT                   INERGYANVIEASAESRASPTTVQGLCYLIGAEDELKLDRVEGVPTAYQKRVLRVELVL
FT                   AKSSLVGRDVSEIASFSGEELKAGSGRGEAEVVEALAYVSKDYIKDGPPKGEYVARMRL
FT                   GLRDALELGMSKEYARVIERVVAVGMRGAGAGGMGRPPATSPRPRPQPSRTAAPRASPP
FT                   TSPASASYYYFAFGSNMQLAQMADRCPGSKVFAKGILPGYRWHINERGVANIVATATQD
FT                   GNDNAVQGILFTVTPKDVKTLDKKEGIAKGYYEKIVLRVKVEPLAISGLKGVKTVVAAG
FT                   KLASNSQAEAREPRKHRHGQDQHGQRAEVAGVREVEALVYLSSQYKKDGRVRAEYVGRM
FT                   QLAMADALKLGVDEAYLRASLHSCILGVDEAAVSAHGKRDFIVRQPAGDASGAAQTSGS
FT                   PKDRRIIERVPAGTGYQAAA"
     MPTTSRHKHR IYFAYGINMH LKQMAKRCPN TRYLGVAKLS GYRWQINERG YANVIEASAE        60
     SRASPTTVQG LCYLIGAEDE LKLDRVEGVP TAYQKRVLRV ELVLAKSSLV GRDVSEIASF       120
     SGEELKAGSG RGEAEVVEAL AYVSKDYIKD GPPKGEYVAR MRLGLRDALE LGMSKEYARV       180
     IERVVAVGMR GAGAGGMGRP PATSPRPRPQ PSRTAAPRAS PPTSPASASY YYFAFGSNMQ       240
     LAQMADRCPG SKVFAKGILP GYRWHINERG VANIVATATQ DGNDNAVQGI LFTVTPKDVK       300
     TLDKKEGIAK GYYEKIVLRV KVEPLAISGL KGVKTVVAAG KLASNSQAEA REPRKHRHGQ       360
     DQHGQRAEVA GVREVEALVY LSSQYKKDGR VRAEYVGRMQ LAMADALKLG VDEAYLRASL       420
     HSCILGVDEA AVSAHGKRDF IVRQPAGDAS GAAQTSGSPK DRRIIERVPA GTGYQAAA         478
//

If you have problems or comments...

PBIL Back to PBIL home page