(data stored in ACNUC16935 zone)

EMBL: BN001307.PE418

BN001307.PE418       Location/Qualifiers
FT   CDS             complement(1156388..1157920)
FT                   /locus_tag="ANIA_01571"
FT                   /old_locus_tag="AN1571.4"
FT                   /product="Alpha-L-arabinofuranosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O74288]"
FT                   /note="transcript_id=CADANIAT00008202"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008202"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008202"
FT                   /db_xref="GOA:O74288"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR036195"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74288"
FT                   /protein_id="CBF85134.1"
FT                   /translation="MTMSRSSRSSVLALALATGSLVAAGPCDIYSSGGTPCIAAHSTTR
FT                   ALYSSYNGPLYQVQRASDGTTTTITPLSAGGVADASAQDAFCENTTCLITIIYDQSGNG
FT                   NDLTQAPPGGFNGPDVGGYDNLAGAIGAPVTLNGKKAYGVFVSPGTGYRNNEAIGTATG
FT                   DEPEGMYAVLDGTHYNDGCCFDYGNAETSSLDTGNGHMEAIYYGTNTAWGYGAGNGPWI
FT                   MADLENGLFSGQSSDYNAGDPSISYRFVTAILKGGPNLWALRGGNAASGSLSTYYNGIR
FT                   PTDASGYNPMSKEGAIILGIGGDNSVSAQGTFYEGAMTDGYPDDATENSVQADIVAAKY
FT                   ATTSLISGPALTVGDTVSLKVTTSGYDTRYIAHTGSTINTQVVSSSSSSTLKQQASWTV
FT                   RTGLASTAAANGCVSFESVDTPGSYIRHSNFALLLNANDGTKLFSEDATFCPQDSFNDD
FT                   GTNSIRSWNYPTRYWRHYENVLYVASNGGVNTFDAATAFTDDVSWVVADGFA"
     MTMSRSSRSS VLALALATGS LVAAGPCDIY SSGGTPCIAA HSTTRALYSS YNGPLYQVQR        60
     ASDGTTTTIT PLSAGGVADA SAQDAFCENT TCLITIIYDQ SGNGNDLTQA PPGGFNGPDV       120
     GGYDNLAGAI GAPVTLNGKK AYGVFVSPGT GYRNNEAIGT ATGDEPEGMY AVLDGTHYND       180
     GCCFDYGNAE TSSLDTGNGH MEAIYYGTNT AWGYGAGNGP WIMADLENGL FSGQSSDYNA       240
     GDPSISYRFV TAILKGGPNL WALRGGNAAS GSLSTYYNGI RPTDASGYNP MSKEGAIILG       300
     IGGDNSVSAQ GTFYEGAMTD GYPDDATENS VQADIVAAKY ATTSLISGPA LTVGDTVSLK       360
     VTTSGYDTRY IAHTGSTINT QVVSSSSSST LKQQASWTVR TGLASTAAAN GCVSFESVDT       420
     PGSYIRHSNF ALLLNANDGT KLFSEDATFC PQDSFNDDGT NSIRSWNYPT RYWRHYENVL       480
     YVASNGGVNT FDAATAFTDD VSWVVADGFA                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page