(data stored in ACNUC16935 zone)

EMBL: BN001307.PE419

BN001307.PE419       Location/Qualifiers
FT   CDS             complement(join(1161180..1161276,1161381..1161547))
FT                   /locus_tag="ANIA_11308"
FT                   /old_locus_tag="AN11308.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008203"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008203"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008203"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN13"
FT                   /protein_id="CBF85136.1"
FT                   /translation="MTVSPAPSQSYPATSQRYPARYSPQTVTSLTPEMVMFAARWIVSV
FT                   SDSIARAGNRPARRDTLDFYLLDGARLASHKSANYLQAQTRY"
     MTVSPAPSQS YPATSQRYPA RYSPQTVTSL TPEMVMFAAR WIVSVSDSIA RAGNRPARRD        60
     TLDFYLLDGA RLASHKSANY LQAQTRY                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page