(data stored in ACNUC16935 zone)

EMBL: BN001307.PE42

BN001307.PE42        Location/Qualifiers
FT   CDS             116117..116443
FT                   /locus_tag="ANIA_09020"
FT                   /old_locus_tag="AN9020.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007833"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007833"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007833"
FT                   /db_xref="GOA:Q5ARR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR0"
FT                   /protein_id="CBF84447.1"
FT                   /translation="MDASDDPQGHQLNELTAQRLQCYQGCAIVRLQNLEFETNPLHGSL
FT                   DFDERKVERLLTIFEIEGCGNLAPEHRVAALINRGTLSKAISQSGITWESLLDPTIQPQ
FT                   LLLE"
     MDASDDPQGH QLNELTAQRL QCYQGCAIVR LQNLEFETNP LHGSLDFDER KVERLLTIFE        60
     IEGCGNLAPE HRVAALINRG TLSKAISQSG ITWESLLDPT IQPQLLLE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page