(data stored in ACNUC16935 zone)

EMBL: BN001307.PE420

BN001307.PE420       Location/Qualifiers
FT   CDS             join(1162629..1163455,1163530..1163959)
FT                   /locus_tag="ANIA_01572"
FT                   /old_locus_tag="AN1572.4"
FT                   /product="toxin biosynthesis protein (Tri7), putative
FT                   (AFU_orthologue; AFUA_8G05970)"
FT                   /note="transcript_id=CADANIAT00008204"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008204"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008204"
FT                   /db_xref="GOA:Q5BD08"
FT                   /db_xref="InterPro:IPR032805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD08"
FT                   /protein_id="CBF85138.1"
FT                   /translation="MASRLAIPPWLTPLTSWTLLQTLTSLTVTFTPSASSLRYVAAAMT
FT                   AICAYIFQTSIQNHFSGAPASGPLVAMCWVNVLNAIDLLVLSRASFDAYLSYRRSKEEK
FT                   KDSRRSSTEDSTKDRLLLALTLPYNYRRINTPWQLSRLPVLTPSSFPSSLTVNNRRKFL
FT                   LHSTVKLILAVIIMQIPLIDPSDPVVLQAVSQLDRSKSVLLLPFCAFTQKGGLHALWLQ
FT                   ARFTLAFGIVIRATIVAAYTAGSIFAVMLGGDPAEWPPVAGSLSEAWTLSRLWGQAWHQ
FT                   TLRRPLASNATFLAALAGFAPKSTVAHWIRVLVTFVESGVVHSACDMGFGIPFGESGGV
FT                   VFFSLQILGLVLESVCQSIAAKVGLRTGGRFSRAVGYIWVSVFMLWTAPVWANPILVNL
FT                   ASDGVNLMSPWLGFPAGSF"
     MASRLAIPPW LTPLTSWTLL QTLTSLTVTF TPSASSLRYV AAAMTAICAY IFQTSIQNHF        60
     SGAPASGPLV AMCWVNVLNA IDLLVLSRAS FDAYLSYRRS KEEKKDSRRS STEDSTKDRL       120
     LLALTLPYNY RRINTPWQLS RLPVLTPSSF PSSLTVNNRR KFLLHSTVKL ILAVIIMQIP       180
     LIDPSDPVVL QAVSQLDRSK SVLLLPFCAF TQKGGLHALW LQARFTLAFG IVIRATIVAA       240
     YTAGSIFAVM LGGDPAEWPP VAGSLSEAWT LSRLWGQAWH QTLRRPLASN ATFLAALAGF       300
     APKSTVAHWI RVLVTFVESG VVHSACDMGF GIPFGESGGV VFFSLQILGL VLESVCQSIA       360
     AKVGLRTGGR FSRAVGYIWV SVFMLWTAPV WANPILVNLA SDGVNLMSPW LGFPAGSF         418
//

If you have problems or comments...

PBIL Back to PBIL home page