(data stored in ACNUC16935 zone)

EMBL: BN001307.PE421

BN001307.PE421       Location/Qualifiers
FT   CDS             complement(join(1164128..1165242,1165305..1165629,
FT                   1165682..1165879))
FT                   /locus_tag="ANIA_01573"
FT                   /old_locus_tag="AN1573.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008205"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008205"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008205"
FT                   /db_xref="GOA:Q5BD07"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD07"
FT                   /protein_id="CBF85140.1"
FT                   /translation="MSVLLVFSLVTFALQGLCSLSLHESDSPHVLQLGLRRNQHNDPVG
FT                   RDRRRFKRQTGTVAVDLHGDSMGGDIYSTNLTIGDPPQAVEVSVDTGSADLWVVYSENP
FT                   VCNVRGARCDDSGTYDPTASTSFDGLSDEFAIEYGDSSWAEGYYGIDTLTVADAEVSEV
FT                   QFAVAVESSIDKGILGIGYSTNVVSTYRYPNLPERLVASNITSSNAYSLWLNRLGSDEG
FT                   TILFGGVNTAHYTGPLRTLPVVRYNGHYIHLWLTLTGMGVESASDDITKSYSETRSTTG
FT                   EQEFPFVALLDSGATLTYLPSNIVAQIFSDLDVHLYEPEQFGYVPCDTYLVGREDYNLT
FT                   FTFSGVTIRVPLRELVLRDAISGPGRDALQLPNNADEESCLFGILPNTDLFPILGDTFL
FT                   RSAYVVFDLDNNEISLAQANTAPGDDRILEIGSGDDAVPEAEDVDDPVTTATVSLGGSS
FT                   LILPTGWTNEPIFPSRTVTTSTTATSTGTNTGSGEDTEATDSDQGTSGGTGTQAEGPVA
FT                   TDGAVGVGNSPLLAIAMAALVLNMVLAL"
     MSVLLVFSLV TFALQGLCSL SLHESDSPHV LQLGLRRNQH NDPVGRDRRR FKRQTGTVAV        60
     DLHGDSMGGD IYSTNLTIGD PPQAVEVSVD TGSADLWVVY SENPVCNVRG ARCDDSGTYD       120
     PTASTSFDGL SDEFAIEYGD SSWAEGYYGI DTLTVADAEV SEVQFAVAVE SSIDKGILGI       180
     GYSTNVVSTY RYPNLPERLV ASNITSSNAY SLWLNRLGSD EGTILFGGVN TAHYTGPLRT       240
     LPVVRYNGHY IHLWLTLTGM GVESASDDIT KSYSETRSTT GEQEFPFVAL LDSGATLTYL       300
     PSNIVAQIFS DLDVHLYEPE QFGYVPCDTY LVGREDYNLT FTFSGVTIRV PLRELVLRDA       360
     ISGPGRDALQ LPNNADEESC LFGILPNTDL FPILGDTFLR SAYVVFDLDN NEISLAQANT       420
     APGDDRILEI GSGDDAVPEA EDVDDPVTTA TVSLGGSSLI LPTGWTNEPI FPSRTVTTST       480
     TATSTGTNTG SGEDTEATDS DQGTSGGTGT QAEGPVATDG AVGVGNSPLL AIAMAALVLN       540
     MVLAL                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page