(data stored in ACNUC16935 zone)

EMBL: BN001307.PE422

BN001307.PE422       Location/Qualifiers
FT   CDS             complement(join(1167333..1167622,1167767..1168097))
FT                   /locus_tag="ANIA_01574"
FT                   /old_locus_tag="AN1574.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008206"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008206"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008206"
FT                   /db_xref="GOA:C8VN16"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN16"
FT                   /protein_id="CBF85142.1"
FT                   /translation="MGPEPRPDSRSSHTDTNTSASLRPRPRPRNEAHLDPDNLELHEIE
FT                   TQQDDDSGVSISSGEYRITTRRTVSRTSTSQTQRPRREGLLGRIQRFWTRHVVLTVAQK
FT                   KNRDYFALERTFLAYIRTSVILAMQGVLIAQLFRLQFAGSSKGLGYHEVGVPLSVTCHC
FT                   AAIVTAILGAHRFWKQQSAIALGTVYAGGWELNCIGFLTTAVS"
     MGPEPRPDSR SSHTDTNTSA SLRPRPRPRN EAHLDPDNLE LHEIETQQDD DSGVSISSGE        60
     YRITTRRTVS RTSTSQTQRP RREGLLGRIQ RFWTRHVVLT VAQKKNRDYF ALERTFLAYI       120
     RTSVILAMQG VLIAQLFRLQ FAGSSKGLGY HEVGVPLSVT CHCAAIVTAI LGAHRFWKQQ       180
     SAIALGTVYA GGWELNCIGF LTTAVS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page