(data stored in ACNUC16935 zone)

EMBL: BN001307.PE423

BN001307.PE423       Location/Qualifiers
FT   CDS             complement(join(1169249..1169339,1169631..1169707,
FT                   1169870..1169891,1169990..1170297,1170445..1170539,
FT                   1170725..1170890,1170952..1171082,1171281..1171605,
FT                   1171664..1171789,1171885..1171962))
FT                   /locus_tag="ANIA_01575"
FT                   /old_locus_tag="AN1575.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008207"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008207"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD05"
FT                   /protein_id="CBF85144.1"
FT                   /translation="MRRPRLPVWETGRQTDREARRLYCFQVSESSRRSATPSSAWARSM
FT                   ISSYSYAWATRTARWQGNERGDAPTGGSSEHRAGADLCIVLISILLLKKTRSRLVSSAV
FT                   SLETVGSESEDRPRQSATSLTIAQAFVGLYLGWSSTSTPKALVQDDVRSRLFPDIEGAT
FT                   GGRKQHRHDQHIHERQQLPWETEYNAYFARFQHAVEMAKQLLTAASSMKPMPTFAVNEA
FT                   LLLLCRWRRYKGIWSSGTAARVLTRVIEIETVGLVPGNSIADFSWIDSVHVDVRCSADC
FT                   CWAKWSIGNAQGQSQTLFYAAPTSAILSYTEPPLSNGHTEPATTSSKVTMASTVMAPTP
FT                   GLPAVSNVLPDISLIRRAYLLNLGGNGFNVAVFASSFPSSLSWHRTKAWSFMIGTACDR
FT                   LLVLGMRHASRLSRSMYMVVQSRLAMTVPQCGRMNIMIAGPPSRSGRRHDLYRGHTAER
FT                   MGPSDIGFQDSGLT"
     MRRPRLPVWE TGRQTDREAR RLYCFQVSES SRRSATPSSA WARSMISSYS YAWATRTARW        60
     QGNERGDAPT GGSSEHRAGA DLCIVLISIL LLKKTRSRLV SSAVSLETVG SESEDRPRQS       120
     ATSLTIAQAF VGLYLGWSST STPKALVQDD VRSRLFPDIE GATGGRKQHR HDQHIHERQQ       180
     LPWETEYNAY FARFQHAVEM AKQLLTAASS MKPMPTFAVN EALLLLCRWR RYKGIWSSGT       240
     AARVLTRVIE IETVGLVPGN SIADFSWIDS VHVDVRCSAD CCWAKWSIGN AQGQSQTLFY       300
     AAPTSAILSY TEPPLSNGHT EPATTSSKVT MASTVMAPTP GLPAVSNVLP DISLIRRAYL       360
     LNLGGNGFNV AVFASSFPSS LSWHRTKAWS FMIGTACDRL LVLGMRHASR LSRSMYMVVQ       420
     SRLAMTVPQC GRMNIMIAGP PSRSGRRHDL YRGHTAERMG PSDIGFQDSG LT               472
//

If you have problems or comments...

PBIL Back to PBIL home page