(data stored in ACNUC16935 zone)

EMBL: BN001307.PE424

BN001307.PE424       Location/Qualifiers
FT   CDS             join(1174761..1174873,1174929..1175368,1175444..1175565,
FT                   1175606..1176190)
FT                   /locus_tag="ANIA_01576"
FT                   /old_locus_tag="AN1576.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008208"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008208"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008208"
FT                   /db_xref="GOA:C8VN18"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN18"
FT                   /protein_id="CBF85146.1"
FT                   /translation="MKFADIPGGSGMIISRGTLSAMGFSALSCLPYCSPFCKIIYAVPA
FT                   FTTYLLNESPLPSLQVSLLTPTNDSILFSASSEIKVPDALTMHLDSMHAEIFRPQPRGR
FT                   PKEDLIPLAEVDISKLHFKGNQKITMKNQTLKLGDVGQFARLVEDAAYHSTFRTAMHAK
FT                   TKVGLAGLTTSIDITKEVEMPGFSNFTELAINDLTIRERDDQGNNIFAETVLFNPTPAS
FT                   VTLVMKLTLWDKGDVTLSILAANHSIGTATSSINNIKSGNNTLSIRAFLDGDVLEENIS
FT                   GIIREQIPYLRKGDIKITATGKSVVYNGQHLEYWETALQAVRVEVTRSVREVVNMVLDT
FT                   LDGDDIVGEDGDDSGFGIFGFEIDIPRVQEGVRSVVEGLVEQILDTAKGLDENEEDTFT
FT                   EELTVLGRLILRLLQVLGVL"
     MKFADIPGGS GMIISRGTLS AMGFSALSCL PYCSPFCKII YAVPAFTTYL LNESPLPSLQ        60
     VSLLTPTNDS ILFSASSEIK VPDALTMHLD SMHAEIFRPQ PRGRPKEDLI PLAEVDISKL       120
     HFKGNQKITM KNQTLKLGDV GQFARLVEDA AYHSTFRTAM HAKTKVGLAG LTTSIDITKE       180
     VEMPGFSNFT ELAINDLTIR ERDDQGNNIF AETVLFNPTP ASVTLVMKLT LWDKGDVTLS       240
     ILAANHSIGT ATSSINNIKS GNNTLSIRAF LDGDVLEENI SGIIREQIPY LRKGDIKITA       300
     TGKSVVYNGQ HLEYWETALQ AVRVEVTRSV REVVNMVLDT LDGDDIVGED GDDSGFGIFG       360
     FEIDIPRVQE GVRSVVEGLV EQILDTAKGL DENEEDTFTE ELTVLGRLIL RLLQVLGVL        419
//

If you have problems or comments...

PBIL Back to PBIL home page