(data stored in ACNUC16935 zone)

EMBL: BN001307.PE426

BN001307.PE426       Location/Qualifiers
FT   CDS             complement(join(1183487..1186068,1186218..1186281))
FT                   /locus_tag="ANIA_01578"
FT                   /old_locus_tag="AN1578.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008210"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008210"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD02"
FT                   /protein_id="CBF85149.1"
FT                   /translation="MFWALTDTKYAGKRRYSTGQAFAKMLPQFLQGSYARYKADTNIFA
FT                   TWLLEAANQCGYQPSSLFASVPTAKKSQQKGKNNASDAEPLHYRATIKDLQKLAEVIAS
FT                   SALTVPEPVLTIAKRAIRLRKVVTSWFLGHGDTTSNERHAHFITVLERICETLEWKSSQ
FT                   STRPDINHPLPTPEAQSDDANVDGFLNRFAVLTVEEPQDTEEAQATPVGSKKVVKVTVV
FT                   EDNNEAEDSYFGLLFFKTLCLLRDLENMRRFISITWSEYRDKKIDLMNAAIVTDSALQL
FT                   ARELVEEVEADWHTSLTGKEDNVQNIVYNYAVLTRGSSAAPSREIGLPYNKNMADIAEW
FT                   CYVPTMVVLESFAKVLQVNHQPVFKKGSFGTYDPKMDRERMSLGQKFNEDQTILFSILP
FT                   EFCMVNRFGIQMPVQDAVTRGVVEFIKTKKVTLWLCFASQIFLDVHHTMRHSTLGAFED
FT                   LRMSGLRIQKTIDDYLQLSKTHPQPRFWPKEGDEEIRNISSTVQSWIIQDRFLDIRVQT
FT                   KLDRIGPPPEKHALFSQHAILCGLILFHLNTRMQFVGQQLLNQWYDVQQLAFLHNLVIK
FT                   SPAHKNLRWPDMDAFIKIHGESHIFIGSRPGDAVESLKRLELVTGISSVANFARDSRSR
FT                   RFHNPNGKHARSLKPTTTVANLFFTKYVEGTEEGAGIVDFDRVLDELSQKSKLGASTEG
FT                   IQRADPQSIITRKWSNTHNIDTLQLLAFLKAKLFEEEPIILYNYFGMHKRSVELLRLIR
FT                   DKEHQKFVQYFTSVYLPDESFISNIVILIHHVVQGSAQNARAMGLASGGVEVGSRILIS
FT                   AGDVMREYLKKNGDLACKELRVFCKNKKPIQDDAYDESESDELVHSWLSLEDVLGPKGV
FT                   ASLMTGIQIA"
     MFWALTDTKY AGKRRYSTGQ AFAKMLPQFL QGSYARYKAD TNIFATWLLE AANQCGYQPS        60
     SLFASVPTAK KSQQKGKNNA SDAEPLHYRA TIKDLQKLAE VIASSALTVP EPVLTIAKRA       120
     IRLRKVVTSW FLGHGDTTSN ERHAHFITVL ERICETLEWK SSQSTRPDIN HPLPTPEAQS       180
     DDANVDGFLN RFAVLTVEEP QDTEEAQATP VGSKKVVKVT VVEDNNEAED SYFGLLFFKT       240
     LCLLRDLENM RRFISITWSE YRDKKIDLMN AAIVTDSALQ LARELVEEVE ADWHTSLTGK       300
     EDNVQNIVYN YAVLTRGSSA APSREIGLPY NKNMADIAEW CYVPTMVVLE SFAKVLQVNH       360
     QPVFKKGSFG TYDPKMDRER MSLGQKFNED QTILFSILPE FCMVNRFGIQ MPVQDAVTRG       420
     VVEFIKTKKV TLWLCFASQI FLDVHHTMRH STLGAFEDLR MSGLRIQKTI DDYLQLSKTH       480
     PQPRFWPKEG DEEIRNISST VQSWIIQDRF LDIRVQTKLD RIGPPPEKHA LFSQHAILCG       540
     LILFHLNTRM QFVGQQLLNQ WYDVQQLAFL HNLVIKSPAH KNLRWPDMDA FIKIHGESHI       600
     FIGSRPGDAV ESLKRLELVT GISSVANFAR DSRSRRFHNP NGKHARSLKP TTTVANLFFT       660
     KYVEGTEEGA GIVDFDRVLD ELSQKSKLGA STEGIQRADP QSIITRKWSN THNIDTLQLL       720
     AFLKAKLFEE EPIILYNYFG MHKRSVELLR LIRDKEHQKF VQYFTSVYLP DESFISNIVI       780
     LIHHVVQGSA QNARAMGLAS GGVEVGSRIL ISAGDVMREY LKKNGDLACK ELRVFCKNKK       840
     PIQDDAYDES ESDELVHSWL SLEDVLGPKG VASLMTGIQI A                           881
//

If you have problems or comments...

PBIL Back to PBIL home page