(data stored in ACNUC16935 zone)

EMBL: BN001307.PE427

BN001307.PE427       Location/Qualifiers
FT   CDS             join(1188333..1188547,1188590..1188781,1188850..1189005,
FT                   1189064..1189231,1189304..1189354,1189492..1189891)
FT                   /locus_tag="ANIA_01579"
FT                   /old_locus_tag="AN1579.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008211"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008211"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008211"
FT                   /db_xref="GOA:C8VN21"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN21"
FT                   /protein_id="CBF85151.1"
FT                   /translation="MAQVCTPESLYGYDHAYKIADQSTLDTIASECTSINGSIYIMSNY
FT                   TGPFYLPNIRNISGDVHWYADTSYLYDSISFPDLEHINGSLDLQAGYNLRNISAPKLNL
FT                   VGRLVQVDYAHDVDLRSLQHAEYASIFGNLSSLRLDSLQSINRTLKICNKDSCSSSLSP
FT                   VTSLELYLLSLESSTYIELEGRISTLVVPELTSVVGLETSPALQSSEGFQLTTAGGPPL
FT                   NLVFPRLDTVYGRFQVSGNIASLSMPKMIDTNMTLEVNAVNLPSLRRASDGIYIYSDMA
FT                   LDCDAIEEEIFRNVSISNGSKTCSAKEAEPESHGLSTGDKAGIGIGSGFAGIIIFVLIP
FT                   LYIRHRKKEKERLKAVSEVELMPPSYQAAQQDRASLPEYSPGEHRPVASPRGT"
     MAQVCTPESL YGYDHAYKIA DQSTLDTIAS ECTSINGSIY IMSNYTGPFY LPNIRNISGD        60
     VHWYADTSYL YDSISFPDLE HINGSLDLQA GYNLRNISAP KLNLVGRLVQ VDYAHDVDLR       120
     SLQHAEYASI FGNLSSLRLD SLQSINRTLK ICNKDSCSSS LSPVTSLELY LLSLESSTYI       180
     ELEGRISTLV VPELTSVVGL ETSPALQSSE GFQLTTAGGP PLNLVFPRLD TVYGRFQVSG       240
     NIASLSMPKM IDTNMTLEVN AVNLPSLRRA SDGIYIYSDM ALDCDAIEEE IFRNVSISNG       300
     SKTCSAKEAE PESHGLSTGD KAGIGIGSGF AGIIIFVLIP LYIRHRKKEK ERLKAVSEVE       360
     LMPPSYQAAQ QDRASLPEYS PGEHRPVASP RGT                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page