(data stored in ACNUC16935 zone)

EMBL: BN001307.PE428

BN001307.PE428       Location/Qualifiers
FT   CDS             complement(join(1191996..1192949,1193020..1193807,
FT                   1193889..1195533))
FT                   /locus_tag="ANIA_01580"
FT                   /old_locus_tag="AN1580.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008212"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008212"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008212"
FT                   /db_xref="GOA:Q5BD00"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD00"
FT                   /protein_id="CBF85153.1"
FT                   /translation="MTSLTRDEYTFAWICALPLEMAAARAMLDKIHSPLPKQSADPNAY
FT                   EVGELNGHYIVIACLPAGVYGTVSAATVVSRMRLTFPRLQYGLMVGIGGGVPGRNNDIR
FT                   LGDVVVSKPVGKYSGVLQYDYGKAVQGGIFEPTGTLNKPPHAFLTHMGQLEAKQMTEGK
FT                   AALSKIVREALEKNPEMTEKFAPPEHYTDRLFHSSYHHIPGEDTCERCDVKQLIKRQPR
FT                   ETRSPYVHYGLIASGDQVMKDSETRDRLARQHGILCFEMEAAGLMDELPTLVIRGICDY
FT                   CDSHKQKQWQSYAALTAAAYAKLLLSIMPVCRTCRTESNASERNLLRHWMVSLERNPRF
FT                   VGRQDELSQLEKLLTAPDGPKRVAITGLGGVGKTQLALEVAHRIRNQDRECSVFWVPCT
FT                   SYAMIEQTFMNIAHMLGLHEVKPAEVKERVKLYLSSQRAGKWLLIFDNADDADMWLTTT
FT                   PALEEILPKSEQGRILFTTRNGELAVELTSSNIIHIPDLDKKTAHDMLDRLVLQKNLLQ
FT                   DPVTTSSFLEQLAYFPLAISQASAYINKKRLRRYNDIQNPVITTWLISFKQIQQQDQLA
FT                   ADYLSFMACLDPRNIPSSLLPNQSTDKQKLDALGLLNAYSFTQCQGTQISMHRLVHIAI
FT                   RNWLRKNGLFSLWIQRVADHLEKLFPNSSHHNRGLWRGYLPHALALVHENEFILQLGQY
FT                   TELFERISGCLTRDGRYSEAEVLYSKLMTINQEKNSYEHPDTLRSMANLASTYWNQGRW
FT                   NEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAG
FT                   RWNEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLGLQVLETRK
FT                   AVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAVLGPEHPDTLTSMANL
FT                   ASTYRNQGRWNDAEKLDVQVLETRKAVLGPEHPDTLTSMANLASTYWNQGRWNEAEKLD
FT                   VQVLETRKAVLGPEHLHTLSSMANLASTYWNQGRWNEAEKLEVQVLETRKAVLGPEHPD
FT                   TLSSMHNLAYTYHSMGRNTEASDLMTQCATLRARNIGSTHPDTLSSSDALTEWQKLDHH
FT                   RSSKPGKGRKLKALGRVLGFK"
     MTSLTRDEYT FAWICALPLE MAAARAMLDK IHSPLPKQSA DPNAYEVGEL NGHYIVIACL        60
     PAGVYGTVSA ATVVSRMRLT FPRLQYGLMV GIGGGVPGRN NDIRLGDVVV SKPVGKYSGV       120
     LQYDYGKAVQ GGIFEPTGTL NKPPHAFLTH MGQLEAKQMT EGKAALSKIV REALEKNPEM       180
     TEKFAPPEHY TDRLFHSSYH HIPGEDTCER CDVKQLIKRQ PRETRSPYVH YGLIASGDQV       240
     MKDSETRDRL ARQHGILCFE MEAAGLMDEL PTLVIRGICD YCDSHKQKQW QSYAALTAAA       300
     YAKLLLSIMP VCRTCRTESN ASERNLLRHW MVSLERNPRF VGRQDELSQL EKLLTAPDGP       360
     KRVAITGLGG VGKTQLALEV AHRIRNQDRE CSVFWVPCTS YAMIEQTFMN IAHMLGLHEV       420
     KPAEVKERVK LYLSSQRAGK WLLIFDNADD ADMWLTTTPA LEEILPKSEQ GRILFTTRNG       480
     ELAVELTSSN IIHIPDLDKK TAHDMLDRLV LQKNLLQDPV TTSSFLEQLA YFPLAISQAS       540
     AYINKKRLRR YNDIQNPVIT TWLISFKQIQ QQDQLAADYL SFMACLDPRN IPSSLLPNQS       600
     TDKQKLDALG LLNAYSFTQC QGTQISMHRL VHIAIRNWLR KNGLFSLWIQ RVADHLEKLF       660
     PNSSHHNRGL WRGYLPHALA LVHENEFILQ LGQYTELFER ISGCLTRDGR YSEAEVLYSK       720
     LMTINQEKNS YEHPDTLRSM ANLASTYWNQ GRWNEAEKLG LQVLETRKAV LGPEHPDTLS       780
     SMANLASTYW NQGRWNEAEK LELQVLETSK AGRWNEAEKL GLQVLETRKA VLGPEHPDTL       840
     SSMANLASTY WNQGRWNEAE KLGLQVLETR KAVLGPEHPD TLSSMANLAS TYWNQGRWNE       900
     AEKLELQVLE TSKAVLGPEH PDTLTSMANL ASTYRNQGRW NDAEKLDVQV LETRKAVLGP       960
     EHPDTLTSMA NLASTYWNQG RWNEAEKLDV QVLETRKAVL GPEHLHTLSS MANLASTYWN      1020
     QGRWNEAEKL EVQVLETRKA VLGPEHPDTL SSMHNLAYTY HSMGRNTEAS DLMTQCATLR      1080
     ARNIGSTHPD TLSSSDALTE WQKLDHHRSS KPGKGRKLKA LGRVLGFK                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page