(data stored in ACNUC16935 zone)

EMBL: BN001307.PE429

BN001307.PE429       Location/Qualifiers
FT   CDS             join(1196151..1196246,1196495..1196566,1196746..1196787,
FT                   1196856..1196882)
FT                   /locus_tag="ANIA_11309"
FT                   /old_locus_tag="AN11309.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008213"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008213"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008213"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN73"
FT                   /protein_id="CBF85155.1"
FT                   /translation="MPILLPLGILAALTYLPRWSMMGDPIHIDLLDLFPNHGRHGYNPF
FT                   FSSAVLATWPWLATGDVVDTPLVIAKKAQLWVN"
     MPILLPLGIL AALTYLPRWS MMGDPIHIDL LDLFPNHGRH GYNPFFSSAV LATWPWLATG        60
     DVVDTPLVIA KKAQLWVN                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page