(data stored in ACNUC16935 zone)

EMBL: BN001307.PE43

BN001307.PE43        Location/Qualifiers
FT   CDS             join(118142..118560,118961..118997,119133..119381)
FT                   /locus_tag="ANIA_09019"
FT                   /old_locus_tag="AN9019.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007834"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007834"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007834"
FT                   /db_xref="GOA:Q5ARR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR1"
FT                   /protein_id="CBF84449.1"
FT                   /translation="MDPHPSGNLDPPPPLAADFEDPSCNYPLERKHYLYGHRKIPEILR
FT                   MWYQSSREVIIIFLFESRIYYKFNRAGGFNLRSTLQDLSREHIFLIINDFGIRVPDTHK
FT                   AYDEALKERLLLVARRDNPGRRKDDVGQISVDKLRECFKLSQYEELGAPQAEWVCGRWG
FT                   GESTIGLPKRCRTPIATAYSHRGEPKMRRRWLCTPGDAIGREIFKRMGKLSSSIVFLSR
FT                   HQKRSQWPKNVD"
     MDPHPSGNLD PPPPLAADFE DPSCNYPLER KHYLYGHRKI PEILRMWYQS SREVIIIFLF        60
     ESRIYYKFNR AGGFNLRSTL QDLSREHIFL IINDFGIRVP DTHKAYDEAL KERLLLVARR       120
     DNPGRRKDDV GQISVDKLRE CFKLSQYEEL GAPQAEWVCG RWGGESTIGL PKRCRTPIAT       180
     AYSHRGEPKM RRRWLCTPGD AIGREIFKRM GKLSSSIVFL SRHQKRSQWP KNVD             234
//

If you have problems or comments...

PBIL Back to PBIL home page