(data stored in ACNUC16935 zone)

EMBL: BN001307.PE431

BN001307.PE431       Location/Qualifiers
FT   CDS             1200259..1201644
FT                   /locus_tag="ANIA_01582"
FT                   /old_locus_tag="AN1582.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008215"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008215"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008215"
FT                   /db_xref="GOA:Q5BCZ8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ8"
FT                   /protein_id="CBF85159.1"
FT                   /translation="MVTIKKPQPFKRALHFSEGEFEERRYRALELMKREQLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHIDGSMKLITRMPDLRQALYTSILKPEDIMIRSDDAS
FT                   SNPVSLVPRVLKQFGINSPNRRIGYEPNSATLTHEIGKLLEEAVDGLCTLVNHSTLFTR
FT                   ELRIVKSPTELRKIRKAAYLADFALIRALKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSKIDRQITLEHAGVYKHYHACLMRTIHIGGVTKLAREMFR
FT                   VNILQMEAAMAALKPGREIGDVFEAYARVADKNGFQDQRFNACGYSLGATFAPTWMDYP
FT                   MFVRGQKVIARPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVALSKLPFCITRKQT
FT                   IAAWKKVKKEDYGFTEEEEDEGENLQDVELSEGDVDAEDYDVEYDFSDYQPSAPPGDPT
FT                   QQA"
     MVTIKKPQPF KRALHFSEGE FEERRYRALE LMKREQLDGF LITKQETLYY LTGYDTFGYV        60
     FFQAMYFHID GSMKLITRMP DLRQALYTSI LKPEDIMIRS DDASSNPVSL VPRVLKQFGI       120
     NSPNRRIGYE PNSATLTHEI GKLLEEAVDG LCTLVNHSTL FTRELRIVKS PTELRKIRKA       180
     AYLADFALIR ALKLAKPGAY EGDLWREIVG TVYEGGGDDP ANENILVSGN KAVLTRYSAG       240
     KSKIDRQITL EHAGVYKHYH ACLMRTIHIG GVTKLAREMF RVNILQMEAA MAALKPGREI       300
     GDVFEAYARV ADKNGFQDQR FNACGYSLGA TFAPTWMDYP MFVRGQKVIA RPGMVFFIHI       360
     ILMDKATDTA SSIGQTVEVT QDGCVALSKL PFCITRKQTI AAWKKVKKED YGFTEEEEDE       420
     GENLQDVELS EGDVDAEDYD VEYDFSDYQP SAPPGDPTQQ A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page