(data stored in ACNUC16935 zone)

EMBL: BN001307.PE436

BN001307.PE436       Location/Qualifiers
FT   CDS             complement(join(1212255..1212799,1212877..1213867))
FT                   /locus_tag="ANIA_01587"
FT                   /old_locus_tag="AN1587.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008220"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008220"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008220"
FT                   /db_xref="GOA:Q5BCZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ3"
FT                   /protein_id="CBF85168.1"
FT                   /translation="MAQPMSGDVPELAPLEVVVPTRRRRMIGWAMLQPGEKVEPSQRFD
FT                   SNITQEHILPPDQKRRRPAVQESEPQHKGHSNAKTKGNMPSKRSSQGSRAPQQSRILLG
FT                   ETKPGADDSIELKREITRLKIENDLRALAESREIQRLQAEVKRLGRLKTELNRAIDRLL
FT                   SDPTRSAAATPESATSNDAILREKERLIERQICSINDLESSLSEAYEHEFLRSRIRNTD
FT                   LPTSTASIEDAMILIKRGVIRTADLLSSCLHPPDLLHLVLQMNAATDLRNLFNSTVKDS
FT                   SILEKTPDLALRAMLFRIVRDQILNSEIWTAFHTEGFMLRAYQRTIQQTAGSEFASTFH
FT                   KASLLYMLDHDPDFEACFLGAQVKELQIYTMRLLDPFFDSAKLTPNEKDLLREMDHLFF
FT                   ETFFFRARCFAPDGIRYEVIHFEPGESFDSVTMEAQDAPQEQLQGQERDKKPLIRLCVH
FT                   GTVVAHRIYETETEGLRKLKLLSQPFLQPSKSRAHSGRAVGEVVSDKAIVVLR"
     MAQPMSGDVP ELAPLEVVVP TRRRRMIGWA MLQPGEKVEP SQRFDSNITQ EHILPPDQKR        60
     RRPAVQESEP QHKGHSNAKT KGNMPSKRSS QGSRAPQQSR ILLGETKPGA DDSIELKREI       120
     TRLKIENDLR ALAESREIQR LQAEVKRLGR LKTELNRAID RLLSDPTRSA AATPESATSN       180
     DAILREKERL IERQICSIND LESSLSEAYE HEFLRSRIRN TDLPTSTASI EDAMILIKRG       240
     VIRTADLLSS CLHPPDLLHL VLQMNAATDL RNLFNSTVKD SSILEKTPDL ALRAMLFRIV       300
     RDQILNSEIW TAFHTEGFML RAYQRTIQQT AGSEFASTFH KASLLYMLDH DPDFEACFLG       360
     AQVKELQIYT MRLLDPFFDS AKLTPNEKDL LREMDHLFFE TFFFRARCFA PDGIRYEVIH       420
     FEPGESFDSV TMEAQDAPQE QLQGQERDKK PLIRLCVHGT VVAHRIYETE TEGLRKLKLL       480
     SQPFLQPSKS RAHSGRAVGE VVSDKAIVVL R                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page