(data stored in ACNUC16935 zone)

EMBL: BN001307.PE437

BN001307.PE437       Location/Qualifiers
FT   CDS             join(1214303..1214842,1214891..1215259,1215312..1215356,
FT                   1215413..1215479,1215529..1215790,1215897..1215966,
FT                   1216044..1216144,1216192..1216369,1216458..1216608,
FT                   1216689..1216918)
FT                   /locus_tag="ANIA_01588"
FT                   /old_locus_tag="AN1588.4"
FT                   /product="HSP70 family protein (AFU_orthologue;
FT                   AFUA_3G13740)"
FT                   /note="transcript_id=CADANIAT00008221"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008221"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008221"
FT                   /db_xref="GOA:Q5BCZ2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ2"
FT                   /protein_id="CBF85170.1"
FT                   /translation="MADLRRLATRKRRRASTIVDQNVCFTGTDTEDGDSMVPETPPSRS
FT                   WSRSQSRGSSRSTWTNQATTETGTETSAIPSTETSVEPSVELTEPFTSRSTSAQSDTLS
FT                   PRTKFIIGLDYGTTFSSVSYIKFDSARPPPTLFGAQICSITDWPGVDSRARNIPEVPSE
FT                   SWYLGDRFYWGYGARQGYAKLLLPGNQKETRGPREELRRTLVRARKDETEAIKDYLRQI
FT                   LKYSKEFLTEREELSEECEVELVFCVPAGWPAKAIRTMQEILLDIAHELNIGTLATPFV
FT                   LNEPEAAAAYILEACSGRKRLSTGEVFMVCDAGGGTVDAITYRVCQQHPFRVEEVVPPT
FT                   GSNCGSSYANQTLKHQAIEKIKSTAYESLKGPSFEYIIEHDIMTEFEYKIKRGFNPADG
FT                   LDGDEVIVVHGLERNERLGFGHNTMRIKSLNGISKLIRQQISAAAAKGLTVETILLVGG
FT                   FSAAPILRSHIETEFEALKIIYPPKGLDSAVTVSHGAVFRAFNKSDGPKRIVQSNFGFL
FT                   QLELYSTRQPAHRGVSPIFNAIDGKKYGLVLSKQQQFRTRNWQVFKMEEELVIHQKIWV
FT                   SDFDNAQNHYRVNAPCNKGAEVFGILQIDLEPVKNEGLLELRSGPEGMFYEIHYELAME
FT                   VDGRNLAVKLFYPPGGMCRAQTQLCIAAAFIPGTE"
     MADLRRLATR KRRRASTIVD QNVCFTGTDT EDGDSMVPET PPSRSWSRSQ SRGSSRSTWT        60
     NQATTETGTE TSAIPSTETS VEPSVELTEP FTSRSTSAQS DTLSPRTKFI IGLDYGTTFS       120
     SVSYIKFDSA RPPPTLFGAQ ICSITDWPGV DSRARNIPEV PSESWYLGDR FYWGYGARQG       180
     YAKLLLPGNQ KETRGPREEL RRTLVRARKD ETEAIKDYLR QILKYSKEFL TEREELSEEC       240
     EVELVFCVPA GWPAKAIRTM QEILLDIAHE LNIGTLATPF VLNEPEAAAA YILEACSGRK       300
     RLSTGEVFMV CDAGGGTVDA ITYRVCQQHP FRVEEVVPPT GSNCGSSYAN QTLKHQAIEK       360
     IKSTAYESLK GPSFEYIIEH DIMTEFEYKI KRGFNPADGL DGDEVIVVHG LERNERLGFG       420
     HNTMRIKSLN GISKLIRQQI SAAAAKGLTV ETILLVGGFS AAPILRSHIE TEFEALKIIY       480
     PPKGLDSAVT VSHGAVFRAF NKSDGPKRIV QSNFGFLQLE LYSTRQPAHR GVSPIFNAID       540
     GKKYGLVLSK QQQFRTRNWQ VFKMEEELVI HQKIWVSDFD NAQNHYRVNA PCNKGAEVFG       600
     ILQIDLEPVK NEGLLELRSG PEGMFYEIHY ELAMEVDGRN LAVKLFYPPG GMCRAQTQLC       660
     IAAAFIPGTE                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page