(data stored in ACNUC16935 zone)

EMBL: BN001307.PE438

BN001307.PE438       Location/Qualifiers
FT   CDS             complement(join(1217058..1217212,1217318..1218554,
FT                   1218610..1219108,1219167..1219642))
FT                   /locus_tag="ANIA_01589"
FT                   /old_locus_tag="AN1589.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008222"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008222"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ1"
FT                   /protein_id="CBF85171.1"
FT                   /translation="MPPMPSEEYRSRYRLTEDLKIKFLGPLEPEKWPTHWPEARRRLFH
FT                   DIVKLGDSKFGTFECTYSSEKPWRAQIKRRAAKLAYLASRCCDEGKNEPSWRASLEHEV
FT                   LYRFTVEVSCPTCRARLWRSEIEAAIESSDSQALSLDERRKHRMPCRCPEGFGTTDFHG
FT                   VNMIFSDRAETSIHYQPPLPIRSRSKGYKKYEQPDRVYGLIETQNIKTLLDSPYQRTTD
FT                   SQVKQLRDLLEVSPFKGDRKPLLFPFLLLEAKSATVGDSAGVEMQSAFTIHRLLKVQDE
FT                   LRAATRVDSMWATGPLVWFFGWHGQDWYVKGSFIDYTSGTPHRYCIVDLWQGNISQQSR
FT                   ALQLLLVVDYIFDWARDIYRPCIIRELSILAAREMQPCDPDIFSTVDRSQSQIASELPG
FT                   FSWSQESDSLYVSTTGLESGLGDTHPLSGVVRDASNIETRFLSLHITEANMDELWVSLP
FT                   AHLRESATTFVDTLRPSLDSSWRVTRKTLFSIQAAWTRNVNAPEFAGGSNTDIASDEIF
FT                   FTNIVILFHMTDDWTLVRQLTYLAISEGALQVLLLRHSLPGLLRDLEAQNPIIDDSSIE
FT                   PFIKSIRRQTIASSLTAAVSMLCISSSFTRGPGRIPGKWLLSKAKNIYAGFVFDNSPST
FT                   LEIVASFHETREKLIVNYFDDPYLVYSRTRTFLSADSPEQGLWPRLDSICQDKHGCALV
FT                   ESLNLPDNSTGAGARFCVFIISKYDFDRSDVDTATIVRGLAEGDSLGLLLEWLEDLGSQ
FT                   SGRAGWSGGGPGETPDSPIMISSSEESEGDPIEED"
     MPPMPSEEYR SRYRLTEDLK IKFLGPLEPE KWPTHWPEAR RRLFHDIVKL GDSKFGTFEC        60
     TYSSEKPWRA QIKRRAAKLA YLASRCCDEG KNEPSWRASL EHEVLYRFTV EVSCPTCRAR       120
     LWRSEIEAAI ESSDSQALSL DERRKHRMPC RCPEGFGTTD FHGVNMIFSD RAETSIHYQP       180
     PLPIRSRSKG YKKYEQPDRV YGLIETQNIK TLLDSPYQRT TDSQVKQLRD LLEVSPFKGD       240
     RKPLLFPFLL LEAKSATVGD SAGVEMQSAF TIHRLLKVQD ELRAATRVDS MWATGPLVWF       300
     FGWHGQDWYV KGSFIDYTSG TPHRYCIVDL WQGNISQQSR ALQLLLVVDY IFDWARDIYR       360
     PCIIRELSIL AAREMQPCDP DIFSTVDRSQ SQIASELPGF SWSQESDSLY VSTTGLESGL       420
     GDTHPLSGVV RDASNIETRF LSLHITEANM DELWVSLPAH LRESATTFVD TLRPSLDSSW       480
     RVTRKTLFSI QAAWTRNVNA PEFAGGSNTD IASDEIFFTN IVILFHMTDD WTLVRQLTYL       540
     AISEGALQVL LLRHSLPGLL RDLEAQNPII DDSSIEPFIK SIRRQTIASS LTAAVSMLCI       600
     SSSFTRGPGR IPGKWLLSKA KNIYAGFVFD NSPSTLEIVA SFHETREKLI VNYFDDPYLV       660
     YSRTRTFLSA DSPEQGLWPR LDSICQDKHG CALVESLNLP DNSTGAGARF CVFIISKYDF       720
     DRSDVDTATI VRGLAEGDSL GLLLEWLEDL GSQSGRAGWS GGGPGETPDS PIMISSSEES       780
     EGDPIEED                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page