(data stored in ACNUC16935 zone)

EMBL: BN001307.PE439

BN001307.PE439       Location/Qualifiers
FT   CDS             complement(join(1221145..1221163,1221216..1222458,
FT                   1222513..1222711,1222781..1223021,1223089..1223267))
FT                   /locus_tag="ANIA_01590"
FT                   /old_locus_tag="AN1590.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008223"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008223"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008223"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ0"
FT                   /protein_id="CBF85173.1"
FT                   /translation="MGKEKHHFSRLPWRKSEPATDEDEAWIRKKAGAHHPAFRTPADYD
FT                   RSEKRYISDEEQAIEYLENLLRKHDDSQPGEPKFYQCSWEVVIQSLTQAQDAYAKNTGC
FT                   GQRTGMALDVTLSAFEALPAEFGLGTVKGILGLMFRVALQGIENRAKILDAFSSIPNTI
FT                   VTINVACTVLRPSQGDLDLREEFYRTLIKGMPLLVDVLLRAAPWYRKLKEILLFRIPET
FT                   VAVDEVLSEWKGIIDSFNQRMQRMRDRMLGTLHQQGVDLQNQADKHFSATENHFRGLRE
FT                   ENSTTHDMMRDLQLMMTVIMYNQKQLSKQKAQEASTWHHGLKSGADATTLLYQELQAIR
FT                   RQGEIQQEENSRLRRENVALREEAALRAETESSWKPTHPSMAALSELELLGVIGVPSNA
FT                   AWRDLDIVLSQSSSFGSQMLGKAQRLIRTRAFRDWFNQSESSILLVEGYLDISPAASIT
FT                   PISILDATLISSLLDSSNTLVLFAFAGLHREYEKPEVMNGPGGLLRSLIMQLLTSDKFP
FT                   LSNLEFLTPERIAACQKGDIVALCALFERLLLQVPPSLQVYCILDGLGWYERNPWGQDL
FT                   LYVISMFEELAQWDFPQTAVIKPMISFPHHSLLVADAVQIPVLWSRRYWD"
     MGKEKHHFSR LPWRKSEPAT DEDEAWIRKK AGAHHPAFRT PADYDRSEKR YISDEEQAIE        60
     YLENLLRKHD DSQPGEPKFY QCSWEVVIQS LTQAQDAYAK NTGCGQRTGM ALDVTLSAFE       120
     ALPAEFGLGT VKGILGLMFR VALQGIENRA KILDAFSSIP NTIVTINVAC TVLRPSQGDL       180
     DLREEFYRTL IKGMPLLVDV LLRAAPWYRK LKEILLFRIP ETVAVDEVLS EWKGIIDSFN       240
     QRMQRMRDRM LGTLHQQGVD LQNQADKHFS ATENHFRGLR EENSTTHDMM RDLQLMMTVI       300
     MYNQKQLSKQ KAQEASTWHH GLKSGADATT LLYQELQAIR RQGEIQQEEN SRLRRENVAL       360
     REEAALRAET ESSWKPTHPS MAALSELELL GVIGVPSNAA WRDLDIVLSQ SSSFGSQMLG       420
     KAQRLIRTRA FRDWFNQSES SILLVEGYLD ISPAASITPI SILDATLISS LLDSSNTLVL       480
     FAFAGLHREY EKPEVMNGPG GLLRSLIMQL LTSDKFPLSN LEFLTPERIA ACQKGDIVAL       540
     CALFERLLLQ VPPSLQVYCI LDGLGWYERN PWGQDLLYVI SMFEELAQWD FPQTAVIKPM       600
     ISFPHHSLLV ADAVQIPVLW SRRYWD                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page