(data stored in ACNUC16935 zone)

EMBL: BN001307.PE44

BN001307.PE44        Location/Qualifiers
FT   CDS             join(119854..120392,120455..120491)
FT                   /locus_tag="ANIA_09018"
FT                   /old_locus_tag="AN9018.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007835"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007835"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007835"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR2"
FT                   /protein_id="CBF84450.1"
FT                   /translation="MTQSSHHVDDVSQFQEFEPWELNSQYAPTPGYIGSPYVSRSSYSP
FT                   SPSRELVNVPEAASQSRPDTLRLLQLSEWEEGRAYDENPPSCIHYLIEWRVTINNRVVA
FT                   KDTDEDLVLAPSAHWQLFLEDKLENVLRRKVSRNRRVRADDTEIVVSVNDRSHRDLTKR
FT                   FDNTDINWTAIEKQLVIGWTLSNRWTER"
     MTQSSHHVDD VSQFQEFEPW ELNSQYAPTP GYIGSPYVSR SSYSPSPSRE LVNVPEAASQ        60
     SRPDTLRLLQ LSEWEEGRAY DENPPSCIHY LIEWRVTINN RVVAKDTDED LVLAPSAHWQ       120
     LFLEDKLENV LRRKVSRNRR VRADDTEIVV SVNDRSHRDL TKRFDNTDIN WTAIEKQLVI       180
     GWTLSNRWTE R                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page