(data stored in ACNUC16935 zone)

EMBL: BN001307.PE440

BN001307.PE440       Location/Qualifiers
FT   CDS             join(1224169..1225990,1226088..1227040)
FT                   /locus_tag="ANIA_01591"
FT                   /old_locus_tag="AN1591.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008224"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008224"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008224"
FT                   /db_xref="GOA:Q5BCY9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY9"
FT                   /protein_id="CBF85175.1"
FT                   /translation="MNRTVGDDWDYTIEVCIGRPNLLEEIREELRRREAIEKKTYSGNH
FT                   RPLMAESPEKIGENRKLHRVRIRSPTVLSHLERLTRKLGNGSILNEEDNLVFMYPFYIL
FT                   GVYLDDMREILADMERGVLASGSIPPSEPEPKGLSPSVSPSPIDQMKCFVQFVESSILP
FT                   IHTALRQLDAQTSRRLSYAEISLLLEPGELIYVAPSLMTTKMLDRSAVQTVFRCLTRIP
FT                   ADHPISIDDSGWLSSDIGRLLADVYCLDHDGEEYTVCWRKLEMEYFDGEKDITALPFYP
FT                   LKFHPNYERFLSNRARQGTAFRALVEDENLHHYYAGWTLITGLFERTESDGKSTESKPE
FT                   DSEYVDSEVFLDTQEARRHMDDWSSLREPFTTKGSLAINDGAKFCLWHMTEKKTVAEKL
FT                   NRILTREDLVYWRARERYLLDNKWVIDDRVFIKEEWTDEDLALLPKRVYGYSLRDRKFL
FT                   RLDVDKFRPHTLKTKANLDKIEIKDSHRMIIRAAVKSHFDRAAQVLNRDEATHVPDIFE
FT                   GKGRGLVILLHGAPGVGKTATAEAVALEFDKPLFQITCGDLGTGPAEVETSLKAIFRYA
FT                   NMWSCILLLDEADVFLTQRNRTDVERNALVSVFLRVLEYYSGVLFLTTNRVGALDEAFR
FT                   SRVHLSLFYPHLNRTDMAKILESNLQRLPRDDKLSPGATAGPNHVTVMDSEIREFVLQQ
FT                   FDEHYKLHERGPWNGRQIRNAVHIAMCLAFFENGRKGRRAPAILTAEHFRKVHETIAEF
FT                   EDYLRAARTVDDETLAQMEGLRYDKEGQAYKRQLVGSTKFHRWSENERQVTHQRQSVRE
FT                   QGQSYRETTSYTPSRRSFLGGDIDSPPESRFSGSGAAARPTSQRYPPREIDDSHLAHER
FT                   YNMSDSGYGETGLRGTPRNYNLSPDRPRTPNRDYLVDGSPESVRSRSSVRGRD"
     MNRTVGDDWD YTIEVCIGRP NLLEEIREEL RRREAIEKKT YSGNHRPLMA ESPEKIGENR        60
     KLHRVRIRSP TVLSHLERLT RKLGNGSILN EEDNLVFMYP FYILGVYLDD MREILADMER       120
     GVLASGSIPP SEPEPKGLSP SVSPSPIDQM KCFVQFVESS ILPIHTALRQ LDAQTSRRLS       180
     YAEISLLLEP GELIYVAPSL MTTKMLDRSA VQTVFRCLTR IPADHPISID DSGWLSSDIG       240
     RLLADVYCLD HDGEEYTVCW RKLEMEYFDG EKDITALPFY PLKFHPNYER FLSNRARQGT       300
     AFRALVEDEN LHHYYAGWTL ITGLFERTES DGKSTESKPE DSEYVDSEVF LDTQEARRHM       360
     DDWSSLREPF TTKGSLAIND GAKFCLWHMT EKKTVAEKLN RILTREDLVY WRARERYLLD       420
     NKWVIDDRVF IKEEWTDEDL ALLPKRVYGY SLRDRKFLRL DVDKFRPHTL KTKANLDKIE       480
     IKDSHRMIIR AAVKSHFDRA AQVLNRDEAT HVPDIFEGKG RGLVILLHGA PGVGKTATAE       540
     AVALEFDKPL FQITCGDLGT GPAEVETSLK AIFRYANMWS CILLLDEADV FLTQRNRTDV       600
     ERNALVSVFL RVLEYYSGVL FLTTNRVGAL DEAFRSRVHL SLFYPHLNRT DMAKILESNL       660
     QRLPRDDKLS PGATAGPNHV TVMDSEIREF VLQQFDEHYK LHERGPWNGR QIRNAVHIAM       720
     CLAFFENGRK GRRAPAILTA EHFRKVHETI AEFEDYLRAA RTVDDETLAQ MEGLRYDKEG       780
     QAYKRQLVGS TKFHRWSENE RQVTHQRQSV REQGQSYRET TSYTPSRRSF LGGDIDSPPE       840
     SRFSGSGAAA RPTSQRYPPR EIDDSHLAHE RYNMSDSGYG ETGLRGTPRN YNLSPDRPRT       900
     PNRDYLVDGS PESVRSRSSV RGRD                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page