(data stored in ACNUC16935 zone)

EMBL: BN001307.PE441

BN001307.PE441       Location/Qualifiers
FT   CDS             join(1228831..1229145,1229204..1229358,1229419..1229827,
FT                   1229884..1230198)
FT                   /locus_tag="ANIA_01592"
FT                   /old_locus_tag="AN1592.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008225"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008225"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008225"
FT                   /db_xref="GOA:Q5BCY8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY8"
FT                   /protein_id="CBF85177.1"
FT                   /translation="MSPPLDSALEPLSEYKETAFPRTEKDPSQYKEHDLVTPEKEIQTG
FT                   YFSPRGSHSSHGSHDSSASSNISLDDARMSDVNNSPNVFHDDPDTIDEKLSMYWKAANE
FT                   TVIREPYDYIAGIPGKEIRRKLLEAFNHWYKVDEQSCQAIATTVGMAHNASLLIDDIQD
FT                   SSKLRRGVPCAHEVFGIAQTINSANYVYFLAQNQLFRLRSWPQAISVFNEEMVNLHRGQ
FT                   GMELFWRDNLLPPSMDDYLQMIANKTGGLFRMIVRLLQTSSRQVIDVEQLVDVLGLYFQ
FT                   ILDDYKNIREEKMAAQKGFFEDLTEGKFSFPICHAIGEGAKNRTALLHMLRLKTDDMKI
FT                   KQEAVCILDNAGSLDYTREVLYGLDRKARSLLREFKTPNPFMEALLDAMLSSLQACH"
     MSPPLDSALE PLSEYKETAF PRTEKDPSQY KEHDLVTPEK EIQTGYFSPR GSHSSHGSHD        60
     SSASSNISLD DARMSDVNNS PNVFHDDPDT IDEKLSMYWK AANETVIREP YDYIAGIPGK       120
     EIRRKLLEAF NHWYKVDEQS CQAIATTVGM AHNASLLIDD IQDSSKLRRG VPCAHEVFGI       180
     AQTINSANYV YFLAQNQLFR LRSWPQAISV FNEEMVNLHR GQGMELFWRD NLLPPSMDDY       240
     LQMIANKTGG LFRMIVRLLQ TSSRQVIDVE QLVDVLGLYF QILDDYKNIR EEKMAAQKGF       300
     FEDLTEGKFS FPICHAIGEG AKNRTALLHM LRLKTDDMKI KQEAVCILDN AGSLDYTREV       360
     LYGLDRKARS LLREFKTPNP FMEALLDAML SSLQACH                                397
//

If you have problems or comments...

PBIL Back to PBIL home page