(data stored in ACNUC16935 zone)

EMBL: BN001307.PE442

BN001307.PE442       Location/Qualifiers
FT   CDS             join(1231956..1232938,1232998..1233265)
FT                   /locus_tag="ANIA_01593"
FT                   /old_locus_tag="AN1593.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008226"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008226"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008226"
FT                   /db_xref="GOA:C8VN86"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN86"
FT                   /protein_id="CBF85179.1"
FT                   /translation="MPESQIIELGTLGQIPLYSLERALQDPLRAVKLRRQIVSQHQATG
FT                   NIDFTTDGSALPYEGYDYKAVLGACCENVIGYMPIPVGVAGPIKINGKMVFLPMSTTEG
FT                   ALVASTNRGCMAINAGGGVTALVLGDGMTRAPIVRFPSLEEAGAAKQWLGSDAGFLIIE
FT                   DAFNASSRFARLQNIKATAVGSDLYIRFTASTGDAMGMNMISKGVEQALEAMQKHGFES
FT                   MDVVSLSGNFCADKKPAAVNWIEGRGKTVTAQATIPEHAVRETLKTSVEALVELNVSKN
FT                   LVGSAVAGALGGFNAHAANVVTAIYLATGQDPAQNVQSSNTLTVMKNVNGDLQISVFMP
FT                   SIEVGTVGGGTVLGPQKAMLHMMGVQGADPEQPGRNAQELALLVAAGVLAGELSLCSAL
FT                   SAGSLVKSHLTHNRKKG"
     MPESQIIELG TLGQIPLYSL ERALQDPLRA VKLRRQIVSQ HQATGNIDFT TDGSALPYEG        60
     YDYKAVLGAC CENVIGYMPI PVGVAGPIKI NGKMVFLPMS TTEGALVAST NRGCMAINAG       120
     GGVTALVLGD GMTRAPIVRF PSLEEAGAAK QWLGSDAGFL IIEDAFNASS RFARLQNIKA       180
     TAVGSDLYIR FTASTGDAMG MNMISKGVEQ ALEAMQKHGF ESMDVVSLSG NFCADKKPAA       240
     VNWIEGRGKT VTAQATIPEH AVRETLKTSV EALVELNVSK NLVGSAVAGA LGGFNAHAAN       300
     VVTAIYLATG QDPAQNVQSS NTLTVMKNVN GDLQISVFMP SIEVGTVGGG TVLGPQKAML       360
     HMMGVQGADP EQPGRNAQEL ALLVAAGVLA GELSLCSALS AGSLVKSHLT HNRKKG           416
//

If you have problems or comments...

PBIL Back to PBIL home page