(data stored in ACNUC16935 zone)

EMBL: BN001307.PE443

BN001307.PE443       Location/Qualifiers
FT   CDS             complement(join(1233605..1235293,1235348..1235634,
FT                   1235697..1236660))
FT                   /locus_tag="ANIA_01594"
FT                   /old_locus_tag="AN1594.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008227"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008227"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008227"
FT                   /db_xref="GOA:Q5BCY6"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR017057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY6"
FT                   /protein_id="CBF85181.1"
FT                   /translation="MTCADVTDLCTQASQLVQQLRTKDGELGFMSAAVYDTAWVSMVQK
FT                   TTPEGRQWLLPKCFEYILRTQLEDGSWETYASDVDGILNTAASLLALETHAESRIASTD
FT                   PPVEEMKERIGRARAALSRQLQAWSVKDTVHVGFEIILPALLRLLREKGHEFEFDGRAE
FT                   LDRLNRIKLSKFRPEYLYSARTTALHSLEAFVGMIDFDKVAHQKVNGSFMFSPSSTAAF
FT                   LMFSSSWDDECEQYLRLVLQNGAGGGTGGMPSAYPSKYFEVSWVRGQLARLESKLTELQ
FT                   ALTTLLDNGYSTGDLGIEDTDSLGEMLRDALVKGGGIVGFAPSIQADADDTAKSLIAVS
FT                   LLDKPVSAQGLIDAFEGPMHFRTYHGERDPSFTANSNVLLALLNTPDAATVSPQIEKAA
FT                   AFLCDVWWTADSEIGDKWNLSPYYPSMLMAEAFGKLLQVWSDGGLKSISSQFIRDRVSV
FT                   CLYQALVRTLQTQNENGSWGSHSHEETAYAILTIAHACQLPVVNQLWTNVQLAVSRGRK
FT                   FLQNSAGDKAEYLWVEKVTYSSILLSKSYVLAALKVSFERSYPACLANLFIVSKKRVIE
FT                   FARFHSMLPLFSSMELWKVRAAIVEGYLLLPQLRDRRLAVFSRTGMEEDKYFEYIPFTW
FT                   TLCNNRRNTFLSTKTLVEMMVISFLNYQADEFMEAVVGRLNSSQRSMTRSCIDEIFRDL
FT                   KDKPELNDAIQAQSGPRNADANGHRILPQAKRIKMGSQLPSDVSRVLSAFVHHVMDHPS
FT                   VKAAAPLEYERVKNELQVFLLSHIEQADDNGRFAAQLESTRDDFETARSSFYRWVSSTS
FT                   SDHTSCPYSFAFYQCLLGFEQASHNAACFQTCEEKYVAEAMCRHLAVMCRMYNDYGSLA
FT                   RDRDEKNLNCVNFPEFAQAGPKSDAVRQKQLFSLAEFERSNMKRGLEVLTEMAAQDRAK
FT                   MRMLEKVQMFCDVTDVYGQIYALEILRVGCDLAHDCFMLELPAQWSNST"
     MTCADVTDLC TQASQLVQQL RTKDGELGFM SAAVYDTAWV SMVQKTTPEG RQWLLPKCFE        60
     YILRTQLEDG SWETYASDVD GILNTAASLL ALETHAESRI ASTDPPVEEM KERIGRARAA       120
     LSRQLQAWSV KDTVHVGFEI ILPALLRLLR EKGHEFEFDG RAELDRLNRI KLSKFRPEYL       180
     YSARTTALHS LEAFVGMIDF DKVAHQKVNG SFMFSPSSTA AFLMFSSSWD DECEQYLRLV       240
     LQNGAGGGTG GMPSAYPSKY FEVSWVRGQL ARLESKLTEL QALTTLLDNG YSTGDLGIED       300
     TDSLGEMLRD ALVKGGGIVG FAPSIQADAD DTAKSLIAVS LLDKPVSAQG LIDAFEGPMH       360
     FRTYHGERDP SFTANSNVLL ALLNTPDAAT VSPQIEKAAA FLCDVWWTAD SEIGDKWNLS       420
     PYYPSMLMAE AFGKLLQVWS DGGLKSISSQ FIRDRVSVCL YQALVRTLQT QNENGSWGSH       480
     SHEETAYAIL TIAHACQLPV VNQLWTNVQL AVSRGRKFLQ NSAGDKAEYL WVEKVTYSSI       540
     LLSKSYVLAA LKVSFERSYP ACLANLFIVS KKRVIEFARF HSMLPLFSSM ELWKVRAAIV       600
     EGYLLLPQLR DRRLAVFSRT GMEEDKYFEY IPFTWTLCNN RRNTFLSTKT LVEMMVISFL       660
     NYQADEFMEA VVGRLNSSQR SMTRSCIDEI FRDLKDKPEL NDAIQAQSGP RNADANGHRI       720
     LPQAKRIKMG SQLPSDVSRV LSAFVHHVMD HPSVKAAAPL EYERVKNELQ VFLLSHIEQA       780
     DDNGRFAAQL ESTRDDFETA RSSFYRWVSS TSSDHTSCPY SFAFYQCLLG FEQASHNAAC       840
     FQTCEEKYVA EAMCRHLAVM CRMYNDYGSL ARDRDEKNLN CVNFPEFAQA GPKSDAVRQK       900
     QLFSLAEFER SNMKRGLEVL TEMAAQDRAK MRMLEKVQMF CDVTDVYGQI YALEILRVGC       960
     DLAHDCFMLE LPAQWSNST                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page