(data stored in ACNUC16935 zone)

EMBL: BN001307.PE444

BN001307.PE444       Location/Qualifiers
FT   CDS             join(1237447..1237451,1237508..1237655,1237729..1237918,
FT                   1237985..1238442)
FT                   /locus_tag="ANIA_01595"
FT                   /old_locus_tag="AN1595.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008228"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008228"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008228"
FT                   /db_xref="GOA:Q5BCY5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY5"
FT                   /protein_id="CBF85182.1"
FT                   /translation="MNTLNAPRNPTRHPAMTADTLVDAPALPHQNGSTEEKLKERGSFG
FT                   KLYTYKRSPRALGIQAVAKSIGLELEQVELQPANGVPDFYWNLNPLGKTPTFVGADGLV
FT                   LTECMAIALHVTNEDSTTTLLGSSSLDFVQIIRWISFTNTDVVTRMASWVRPLIGYTPY
FT                   SKEEVLKAQQQTTQAIGVFEDSLRDRKYLVGDRLTLADIMCVSLVSFGFAQIFDKEWRE
FT                   AFPYFSGWYMMVMHLPIMKAVVEEVPFVEEGLPNAPPTEPFRAP"
     MNTLNAPRNP TRHPAMTADT LVDAPALPHQ NGSTEEKLKE RGSFGKLYTY KRSPRALGIQ        60
     AVAKSIGLEL EQVELQPANG VPDFYWNLNP LGKTPTFVGA DGLVLTECMA IALHVTNEDS       120
     TTTLLGSSSL DFVQIIRWIS FTNTDVVTRM ASWVRPLIGY TPYSKEEVLK AQQQTTQAIG       180
     VFEDSLRDRK YLVGDRLTLA DIMCVSLVSF GFAQIFDKEW REAFPYFSGW YMMVMHLPIM       240
     KAVVEEVPFV EEGLPNAPPT EPFRAP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page