(data stored in ACNUC16935 zone)

EMBL: BN001307.PE445

BN001307.PE445       Location/Qualifiers
FT   CDS             complement(join(1238668..1239317,1239372..1239723))
FT                   /locus_tag="ANIA_01596"
FT                   /old_locus_tag="AN1596.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008229"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008229"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008229"
FT                   /db_xref="GOA:Q5BCY4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY4"
FT                   /protein_id="CBF85184.1"
FT                   /translation="MVSLKTVQASNAGLRALPNITALFVGGTSGIGQSTLRQLARYADS
FT                   PTAYIIGRNEARTRPFLSELQQLNPKGRFHFIEADVSLVRNVDAACQQILQQQKKLNFL
FT                   FMTPGGISLGGRNETVEGIDYLFALRYYSRMRFIQNLLPLLEASSPSRVISVYGGGFEY
FT                   SINTADLDLKHNFSLLNAYKHSITMTSLSMEHLARTHPAVSFIHVYPGLVGTNIYTNSF
FT                   PAPVSTFYNYLVWPFMKPFSVDLGESGERHLFHLSSAHYPAKQGIVPQGVPLEAGEVAK
FT                   GITGEPGSGAYLLNWKGDVRPSTKILAQYREQKIPQLVWDHTESLMDQAVHR"
     MVSLKTVQAS NAGLRALPNI TALFVGGTSG IGQSTLRQLA RYADSPTAYI IGRNEARTRP        60
     FLSELQQLNP KGRFHFIEAD VSLVRNVDAA CQQILQQQKK LNFLFMTPGG ISLGGRNETV       120
     EGIDYLFALR YYSRMRFIQN LLPLLEASSP SRVISVYGGG FEYSINTADL DLKHNFSLLN       180
     AYKHSITMTS LSMEHLARTH PAVSFIHVYP GLVGTNIYTN SFPAPVSTFY NYLVWPFMKP       240
     FSVDLGESGE RHLFHLSSAH YPAKQGIVPQ GVPLEAGEVA KGITGEPGSG AYLLNWKGDV       300
     RPSTKILAQY REQKIPQLVW DHTESLMDQA VHR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page