(data stored in ACNUC16935 zone)

EMBL: BN001307.PE446

BN001307.PE446       Location/Qualifiers
FT   CDS             join(1239993..1240282,1240340..1240851,1240943..1241028)
FT                   /locus_tag="ANIA_01597"
FT                   /old_locus_tag="AN1597.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008230"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008230"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY3"
FT                   /protein_id="CBF85186.1"
FT                   /translation="MVDATSPPGVNAVVNYYVPNSDGSPPATNDMAVMLGQKDMISHKM
FT                   RIRDLRPYKEEYSLDRNGFQYATIHSTLTDATDETQIKEVYYREIEKLVQDITGAKRVL
FT                   AFHHAVRTRTGNEFGEQIKDRYQGVEGPAYRVHIDQTPQGALSIVQFMFPDLADDVRNG
FT                   SFQVINVWRPLTRVQRDPLMVADAAEMPPEDLLLISRKYYNGLHSSNFVIKYDGRMAAG
FT                   EGPTDGLSGDGKHSWWYIGDQEPTEALVFSSSGFRNGKAIIGTAHDLYSAEPMINAYER
FT                   KNASSLYGHDESQI"
     MVDATSPPGV NAVVNYYVPN SDGSPPATND MAVMLGQKDM ISHKMRIRDL RPYKEEYSLD        60
     RNGFQYATIH STLTDATDET QIKEVYYREI EKLVQDITGA KRVLAFHHAV RTRTGNEFGE       120
     QIKDRYQGVE GPAYRVHIDQ TPQGALSIVQ FMFPDLADDV RNGSFQVINV WRPLTRVQRD       180
     PLMVADAAEM PPEDLLLISR KYYNGLHSSN FVIKYDGRMA AGEGPTDGLS GDGKHSWWYI       240
     GDQEPTEALV FSSSGFRNGK AIIGTAHDLY SAEPMINAYE RKNASSLYGH DESQI            295
//

If you have problems or comments...

PBIL Back to PBIL home page