(data stored in ACNUC16935 zone)

EMBL: BN001307.PE449

BN001307.PE449       Location/Qualifiers
FT   CDS             complement(1249097..1250053)
FT                   /locus_tag="ANIA_01600"
FT                   /old_locus_tag="AN1600.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008233"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008233"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008233"
FT                   /db_xref="GOA:C8VN93"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN93"
FT                   /protein_id="CBF85192.1"
FT                   /translation="MPSGRSNSNITMAQLLVVLGATGQQGISVINHVLSDPILSSKYSI
FT                   RGVTRDASKPAAQDLMMKSLDIVSADFDDPASIYAALRGAHTVFAMTCTIYDEHAKTRE
FT                   EDQGKTIADAAVAVGARYLIWSTATHAGNTSGGKYSVPAFDVRWDVEQYIRGLPIQSAF
FT                   VAPATFMQNLRDMMAPQPCEDGTYAIANIHSPQTRFPWLDVVADLGKFVGAILEQPEKY
FT                   DGKVLGASSCIHSLVEVAQILSKVSGRTVKYVVMPESKFRSFCPPDGADSIVNMFLFIQ
FT                   DYGYYGVETEKVVEWSIQQVTGRLITIEEFAKTLHFA"
     MPSGRSNSNI TMAQLLVVLG ATGQQGISVI NHVLSDPILS SKYSIRGVTR DASKPAAQDL        60
     MMKSLDIVSA DFDDPASIYA ALRGAHTVFA MTCTIYDEHA KTREEDQGKT IADAAVAVGA       120
     RYLIWSTATH AGNTSGGKYS VPAFDVRWDV EQYIRGLPIQ SAFVAPATFM QNLRDMMAPQ       180
     PCEDGTYAIA NIHSPQTRFP WLDVVADLGK FVGAILEQPE KYDGKVLGAS SCIHSLVEVA       240
     QILSKVSGRT VKYVVMPESK FRSFCPPDGA DSIVNMFLFI QDYGYYGVET EKVVEWSIQQ       300
     VTGRLITIEE FAKTLHFA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page